KEGG   Methylobacterium radiotolerans: Mrad2831_5293Help
Entry
Mrad2831_5293     CDS       T00674                                 

Definition
(GenBank) hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5609961..5610380)
Genome map
AA seq 139 aa AA seqDB search
MNSPSDTDTPHESAAARSVRQRRDAADRAREHRERQRAEFDRLRARVAKLEARVAELEPL
VTHAEVDCLVVAGLARAIARAPTHRREAPVAGSVAVAAIIDQCGKAGRAAGGDYAECAHA
AGGRLQAAVLQFAPRARTA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaccatcagacaccgacaccccgcacgagagtgccgcggcccgctcagtccgg
cagcggcgcgatgccgccgaccgcgctcgtgagcatcgcgagcggcagcgcgccgagttc
gaccgcctgcgcgcacgcgttgccaagcttgaggcgcgggtcgcggagcttgagcctttg
gtgacgcacgccgaagtcgactgcctggtggtcgccggcctcgcccgcgctatcgccagg
gcgccgacccaccgccgcgaggcgcccgtggcgggcagcgtcgcggtggccgccatcatc
gatcagtgcggcaaggcggggcgcgctgcaggtggcgactacgcggagtgcgcccacgcg
gccggggggcggcttcaagccgccgtcctacagttcgccccacgggcgcggaccgcttaa

DBGET integrated database retrieval system