KEGG   Methylobacterium radiotolerans: Mrad2831_5294Help
Entry
Mrad2831_5294     CDS       T00674                                 

Definition
(GenBank) hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: ACB27241
JGI: Mrad28315294
UniProt: B1LXC0
Position
5610876..5611841
Genome map
AA seq 321 aa AA seqDB search
MLPISRYLATHLVLSSKLFILADGKPIAAGDRVDAKAVRLALAVLSRAAARQVDRGEWLD
ARWDHEHLSGRPRETVTVPLARLRVDLGKVTLGGLVEAHGRAANIQASILGEPGFGEHPI
LDAGVHAQAGQTKHRIAKATNTVDFRVDRTLAAVAHLYADANDDELDPRPFGYDPTVMAA
FSCRYSPLAYLRVLAWTEDGARLPRGWRARRVRGGLLSVEIPVPEVQQALGATGMPNASA
IEAQLIRPVAEDLRRVGMTVDWGWERSPKMKGPRALVLRVSDPREACAPARTRTPTAMRR
PRPRPAPSGLRALRPQIPACR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgctacccatcagccgctacctggcgactcacctcgtcctgtcgtcgaagcttttcatc
ctcgccgacggcaagcccatcgccgcgggcgaccgcgtcgacgccaaggccgtccgcctg
gcgctggcagtgctgtcccgggctgccgcccggcaggtcgaccgcggcgagtggctcgat
gccaggtgggatcacgagcacttgtccgggcggccccgcgagaccgttacggtgccactg
gcccggctgcgcgtcgacctcggcaaggtgacgctgggcgggctcgtcgaggcccacggc
cgggcggccaacatccaagcgagcatcctcggcgagcctgggttcggggagcaccccatc
ctcgatgccggcgtccacgcacaggccgggcaaaccaagcaccgcatcgccaaggcgacc
aatacggtcgatttccgcgtcgaccgaacgctggcggcggtcgcccatctctacgccgac
gcgaacgacgacgagctcgacccaaggccgttcggctacgacccgaccgtgatggcggcg
ttctcgtgccgctacagcccgctcgcctacctacgagtgctggcatggaccgaggatggc
gcgaggcttccgcggggctggcgggcccggcgcgtccggggcgggctcctgtccgtcgag
atccccgtccccgaggtgcagcaggccctcggcgccacgggcatgccgaacgcgtcggcc
atcgaggcgcagctaatccgcccggtcgcggaggacctccgccgggtcggcatgaccgtc
gactggggttgggagcgctcgcccaagatgaagggcccgcgcgccctcgtgctccgggtg
agcgacccgagggaggcgtgcgcgccggcgaggacgcgcacgccaacggctatgcggcgg
ccgcggccccgtccggcgccgtcgggtctgcgggcgctgcgtccccagatcccggcatgt
cgatga

DBGET integrated database retrieval system