KEGG   Methylobacterium radiotolerans: Mrad2831_5295Help
Entry
Mrad2831_5295     CDS       T00674                                 

Definition
(GenBank) hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Prim-Pol
Motif
Other DBs
NCBI-ProteinID: ACB27242
JGI: Mrad28315295
UniProt: B1LXC1
Position
complement(5611765..5615814)
Genome map
AA seq 1349 aa AA seqDB search
MSPTTQSFLTTETPPAIADVLARYGATVVRVRVASEIDREAEAAEAAAQAAAAEERARKA
AWEAEERLQRFSAVAPACVANGWSLFPQARSGRRGPILVKQPGRSSKALQWKPLQERLPT
ADELSWWAESDGPRNRANVALIMGEVSGRALCLDIDVSDPTLAQAILALVDRHLGRTEFR
RVGRAPRLVLIYRSDVSDPVRNKTYALDAKDDGGNDQAIEVLADRKPVTGFGAHHKTGAH
FQWVGACRPDTHGPEHAPVITQAQVEDFISAVDAAGIIVPNLRNAVAWGDGVPLDPALVT
ASGFIQPAVNQAMAGVKWDAKGKVIAGREAFLHSRAFSYVVRNPGMALTDEGRYALAGHL
IAEVTDLFAAGGDRFRSSTELARGCRERIDSAAAKLARGEVRARGIVRDEATGKVSVAPV
VPHAVECTESDDLAWLPSERAQLPEDVVFTPADPALARDRALISDAERGEQAGRVATQIV
GVMESFLAEVRRDRHLGEEAPVRPVRLLRAPTGAGKSSTAVKVVTEDLAQRGPIGGALLF
LQPSYDNIHENVERFQATKRGAWAVFQKNAKQAAKDLPQGTKYLILEGKERGGCLRTEEQ
GILRAAGISSAGLCKASVEDGVGGSEEKRCPHYDVCPVIAARAKIGEAQVIFAPSAFLTS
PSLPAGLEKAVAGVIGDERMWTEVLRWATFPTLTLDTPRAPPRTYKRDGGETGDELMAAR
HYAAATAAEAIRGHYDVAATLVLRHGMEKAEAMVEGAIKVTGRAQEAGRKLRPDMSVEAV
RALAERPTGKHLREELRFWKIVSERLLALKMDATARDLNGGVDRLGSDGRPMPGLARGDR
DYRIQSLDGGKTIRISWRADANFSEHPVLLLDASADVGLTSKCWGGRDVEVSDVDAKLNL
RTLLLADRTWRTSAFRMDLAGEDKKARRAVATAIGQVRSAITTAAVLYGHGRIVVGAPKS
VRTALMHTWAEPPNTDWMHYGAVRGLDFAREHLVAFSVGRHEFPVRFIDGVVAAATYDDE
EPEFPIDAWGDGYLHNEDGTFAVDDYGHAIEVRPPQVRRTHPLRNGGSVTVTVSEYEGRW
AKVICAQFREEELKQFAGRLRPVYRLGEAPLWIAGSRCLPEHFVVDDVVSMSDLADPARV
GALADALRRTGVADADVFGEVAFDSWLKKAPETVLHELGLDGADMTSRWAKAMKAVRIEV
DGGEAVERQVPAWVLDADLREHVVAAYRAAGREVETVEYLGRGAQPAGGIARSEDGDKVV
AVVGTRAERADAELAARDAVAETFEKIASNFRTDARTLFTPGGIDMGIQVILHANPPVPT
EEGEVIDMPGSGDAAPADPTAPDGAAAAA
NT seq 4050 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccgacgacacaatctttcctaacgaccgagaccccgcccgccatcgccgacgtc
ctcgcgcgctacggcgctacggtcgtccgcgtgcgtgtcgcctcggagatcgaccgcgag
gccgaggccgccgaagccgccgcccaggccgccgccgccgaggagcgcgcccgaaaggcc
gcgtgggaggccgaggagcggctgcagaggttcagcgccgtcgccccggcgtgcgtcgcc
aacggctggtcgctgttcccgcaggcccgctccggccgccgcggcccgatcctcgtcaag
caacccggcaggtcgtcgaaggcgctccagtggaagccgctccaagagaggctgcccacc
gccgacgagctctcctggtgggccgagagcgacggcccgcggaacagggccaacgtcgcg
ctgatcatgggcgaggtctcgggtcgggccctatgcctcgacatcgacgtcagcgacccg
acgctcgcccaagccatcctcgcactcgtcgaccggcacctcgggcggactgaattccgc
cgcgtcgggcgcgccccgcgcctcgtgctgatctaccgctcggacgtgagcgacccggtc
cggaacaagacctacgccctcgacgccaaggacgacggcgggaacgaccaagccatcgag
gtcctcgccgaccggaagcccgtcaccgggttcggcgcccaccacaagacaggcgcgcac
ttccagtgggtaggcgcctgccgcccggacacccatgggcccgagcacgcccccgtcatc
acgcaggcccaggtcgaggacttcatctccgcggtcgatgcggccggcatcatcgtcccg
aacctcaggaatgccgtggcctggggcgacggcgtccctctggacccggcgctcgtcacc
gcgtccggcttcatccagcccgccgtcaaccaggcgatggccggcgtgaagtgggacgcc
aagggtaaggtcatcgccggccgcgaggcattcctgcacagccgagcgttctcctacgtc
gtccggaaccctggcatggcgctgacggacgagggtcgctacgcattggccgggcacctg
atcgccgaggtcaccgacctgttcgctgccggcggcgaccggttccggtcctcgacggag
ctagcccgtggctgccgggagcgcatcgacagcgcggcggcgaagctggctcgcggcgag
gtcagggcccgcggcatcgtccgggacgaggcgaccggcaaggtctcggtcgccccggtc
gtgccgcacgccgtcgagtgcacggaatcggatgacctcgcatggctgccgtcggagcgc
gcgcagcttcccgaggacgtcgtcttcacacccgccgacccggccctcgcccgcgaccgg
gcgctaatctcggacgccgagcgcggcgagcaggcgggccgcgtcgccacgcagatcgtc
ggcgtgatggagagtttcctcgcggaggtgcggcgcgaccgccacctcggcgaggaagcc
ccggtccgcccggtgcggctgctccgcgccccgaccggcgccggcaagagctcgaccgcc
gtcaaggtggtcaccgaggacctcgcccagcgcggccccatcggtggtgcgctcctgttc
ctgcagccgtcctacgacaacattcacgagaacgtggagcgcttccaggcgacgaagcgc
ggcgcctgggccgtgttccagaagaacgccaagcaggcggcgaaggatttgccgcagggc
acaaagtacctcatcctggagggcaaggagaggggcggctgcctccgcaccgaggagcag
ggtatcctgcgcgccgccgggatctcgtcggccgggctgtgcaaggcctcggtcgaggac
ggcgtcggcggcagtgaggagaagcgctgcccgcactacgacgtctgccccgtcatcgcc
gcgcgcgccaagatcggcgaagcgcaagtgatcttcgcgccgtcggcgttcctcacgagc
ccgtcgctcccggccgggctggagaaggcggtcgccggggtcatcggggacgagcggatg
tggacggaggtcctgcgctgggcgaccttcccgacgctgaccctcgatacgccccgtgcc
ccgccgcgcacctacaagcgtgacggcggcgagaccggcgacgagctgatggccgcccgg
cactatgcggccgccactgccgccgaggcgatccgcggccactacgacgtcgccgcgacg
ctcgtcctccggcacgggatggagaaggccgaggctatggtcgagggcgcgatcaaagtg
accggccgcgcgcaggaagcaggccggaagctccggccggacatgtccgtcgaggccgtg
cgcgccctggccgagcgcccgaccggcaagcacttgagggaagagttgaggttctggaag
atcgtctccgagcgcctgctggcgttgaagatggacgccaccgcgcgtgatctgaacggc
ggcgtcgaccggctcggcagcgacggacgcccgatgcccggcctcgcccggggcgaccgg
gactaccgcatccagagcctcgacggcgggaagaccatccgcatctcctggcgggcggac
gcgaatttttccgagcacccggtgctgctcctcgacgcctcggcagacgtcgggctgacg
agcaagtgctggggcggccgggacgtcgaggtctccgatgtcgacgccaagctgaacttg
aggaccctcctgctcgccgaccggacctggcgcacgagcgcgttccggatggacctcgcg
ggggaggacaagaaggcccgccgggccgtagccacggccatcgggcaggtccgctcggcc
atcaccaccgcggcggtcctgtacggacacggacgcatcgtggtcggggcgccgaagtcc
gtgcggaccgccctgatgcatacgtgggcggagccgccgaacaccgactggatgcactac
ggtgccgtgcgcggcctggatttcgcccgcgagcacctcgtggcgttctcggtcggccgg
cacgagttcccggtgcggttcatcgacggcgtcgtggccgcggcgacctacgacgacgag
gagcccgagttccccatcgacgcatggggcgacggctacctgcacaacgaggacggcacg
ttcgccgtcgacgactacggccacgccatcgaggtgcgcccgccccaggtccggcgcacg
catccgctgcggaacgggggctcggtgaccgtcacggtctcggagtacgagggccggtgg
gccaaggtcatctgcgcgcagttccgggaggaggagctcaagcagttcgccggccgcctc
cggccggtctaccggctcggcgaggctcccctgtggatcgccgggagccggtgcctgcca
gagcacttcgtcgtcgacgacgtcgtcagcatgtccgacctcgccgatcccgcacgcgtc
ggcgccctcgccgacgcactgcggcggaccggcgtcgcggacgccgacgtgttcggcgag
gtcgcgttcgattcctggctgaagaaggcgcccgagaccgtactgcacgagctcggcctg
gacggcgccgacatgaccagccggtgggccaaagccatgaaggcggtccggatcgaggtc
gacggcggcgaggcggtcgagcggcaggtcccggcctgggtgcttgacgccgacctgcgc
gagcacgtcgtggccgcctaccgcgccgccggccgagaggtcgagaccgtggagtacctc
ggccgcggcgcccagccggcgggcgggatcgccaggtccgaggacggcgacaaggtcgtg
gccgtcgtcgggacccgggcggagcgcgccgacgccgagctcgccgcccgggacgcggtc
gccgagacgttcgagaagatcgcctcgaacttccgaacggatgccaggacgctgttcacg
ccgggcggcatcgacatgggcatccaggtcatcctgcacgccaaccccccggtgccgacc
gaggagggcgaggtcatcgacatgccgggatctggggacgcagcgcccgcagacccgacg
gcgccggacggggccgcggccgccgcatag

DBGET integrated database retrieval system