KEGG   Methylobacterium radiotolerans: Mrad2831_5317Help
Entry
Mrad2831_5317     CDS       T00674                                 

Definition
(GenBank) hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5626459..5626980)
Genome map
AA seq 173 aa AA seqDB search
MRLTTRTPSRPRSLIVGCAAAACAFLAVSSEAPGQAGSGSAEALVNGIQTIRRGDTVTKL
DRTGKGAVLCMRGILQAMRAVGQACHAGADPDFQQELRAALARIDRFIADNAPDRTVPPH
DGTTEPEQRPGAVCGRDAEALYEALRTGGAAGLRARVDDLLSIPREPVMNPCL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgacgacacgcacgccgtcccgaccgcgatccctgatcgtcggctgcgccgcc
gcggcctgcgcgttcctggcggtgtcctcggaggctcccgggcaggccggatcgggatcg
gcggaggcgctcgtgaacgggatccagaccatccggcgcggcgacaccgtcacgaagctc
gaccggaccggcaagggtgcggtgctgtgcatgcgcggcatcctgcaggcgatgcgcgcc
gtcggacaggcgtgccacgccggcgccgacccggacttccagcaggaactgcgcgccgcg
ctcgcgcgcatcgatcggttcatcgccgacaacgccccggacaggaccgtcccgccgcac
gacgggacgacggaaccggagcagcggcccggcgcggtctgcggccgcgacgcggaggcc
ctgtacgaggccctgcggaccggcggcgccgcgggcctgcgcgcccgggtcgacgacctg
ctctcgatcccgcgcgagcctgtcatgaacccgtgcctgtga

DBGET integrated database retrieval system