KEGG   Methylobacterium radiotolerans: Mrad2831_5321Help
Entry
Mrad2831_5321     CDS       T00674                                 

Definition
(GenBank) dihydroorotase, homodimeric type
  KO
K01465  dihydroorotase [EC:3.5.2.3]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00240  Pyrimidine metabolism
mrd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mrad2831_5321
Enzymes [BR:mrd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.2  In cyclic amides
    3.5.2.3  dihydroorotase
     Mrad2831_5321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1
Motif
Other DBs
NCBI-ProteinID: ACB27268
JGI: Mrad28315321
UniProt: B1LXE7
Position
5629389..5630468
Genome map
AA seq 359 aa AA seqDB search
MGVAELFPAERQEANPVDRITIRRPDDWHIHLRDGAMLKAVLPYTAAQFARGIIMPNLVP
PVTTVAAAQAYRERILAALPEGQDFTPLMTCYLRDDTDPDEIERGFGEKVWVAAKLYPAG
ATTNSHAGVTDLNGIAPVLERMERIGMPLLIHGEATDPEIDIFDREAAFMEGSLIPLLGR
HQGLKVTVEHATTAEILDVVREHRSRCAATITPHHLVINRTHIFQGGLRPHLYCLPVAKR
ERHRLALRRAATSGEACFYLGTDTAPHVRGAKEASCGCAGVFCGPSALQTYVQVFDEEGA
LDKFEAFASLNGARFHGLEPNAGTVTLERRESRIAEAVAVDDTAVVVFRGEETLPWSVA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcgccgagctgttccccgccgagcgccaggaggcgaacccggtcgaccggatc
acgatccgccggccggacgactggcacatccacctgcgcgacggcgccatgctgaaggcg
gtgctgccctacacggcggcgcagttcgcccggggcatcatcatgccgaacctcgtgccg
ccggtgaccacggtcgcggccgcgcaggcctatcgcgagcgcatcctggcggccctgccc
gagggccaggacttcacgccgctgatgacctgctacctgcgggacgacaccgacccggac
gagatcgagcgcggcttcggggagaaggtctgggtcgccgccaagctctacccggcgggc
gcgaccacgaactcgcacgcgggcgtcaccgacctcaatggcatcgcgcccgtgctggag
cggatggagcggatcggcatgccgctcctgatccacggcgaggcgaccgacccggagatc
gacatcttcgaccgcgaggccgccttcatggagggcagcctgatcccgctcctcggccgc
catcaggggctgaaggtcaccgtggagcacgccaccaccgcggagatcctcgacgtggtc
cgcgagcaccggagccggtgcgcggcgacgatcacgccgcaccacctcgtgatcaaccgg
acgcacatcttccagggtggcctgcgcccgcacctgtactgcctgccggtggccaagcgc
gagcggcaccggctcgccctgcgccgggccgcgacctccggcgaggcctgcttctatctc
ggcaccgacacggccccgcatgtccgcggcgccaaggaggcgtcctgcggctgcgccggc
gtgttctgcggcccgagcgcgctccagacctacgtgcaggtcttcgacgaggagggggcg
ctggacaagttcgaggctttcgcgtcgctcaacggcgcccgcttccacggtctggagccg
aatgccgggaccgtcaccctggagcgccgggagagccgcatcgccgaggccgtcgcggtc
gacgacacggcggtggtggtgttccgcggcgaggagacgctgccctggtcggtggcgtga

DBGET integrated database retrieval system