KEGG   Methylobacterium radiotolerans: Mrad2831_5328Help
Entry
Mrad2831_5328     CDS       T00674                                 

Definition
(GenBank) pyridoxamine 5'-phosphate oxidase-related FMN-binding
  KO
K07006  
uncharacterized protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5637612..5638265
Genome map
AA seq 217 aa AA seqDB search
MASLYSDAHRALQEEFGTTKLAVRLDEDWVHDSVQPDEAAFIGSRDMFFLSTVDPDGMPT
VSYKGGPTGFVKVLDDKTLVFPGFDGNGMFYSMGNIEGQAKVGLLFIDFETPHRIRVQGH
ASLLRDDALMAEYTEAKYLVRVAVTKIWVNCPRYIHKYKKLEQNKYVPRPDRETPLAAWK
RLDLAGDVISDADKARVAKEGKLEVSEYAALVARGEA
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgctctattccgacgcgcaccgggcgctccaggaggagttcggcacgaccaag
ctcgccgtgcgcctcgacgaggactgggttcacgacagcgtccagccggacgaggccgcg
ttcatcggctcccgcgacatgttcttcctgtcgaccgtcgatccggacgggatgcccacc
gtctcctacaagggcggccccacgggcttcgtgaaggtgctcgacgacaagacgctcgtc
ttccccggattcgacggcaacggcatgttctactcgatgggcaatatcgaggggcaggcc
aaggtcggcctgctgttcatcgacttcgagacgccgcaccgcatccgcgtgcaggggcac
gcgtcgctgctgcgcgacgacgccctcatggccgagtataccgaggccaagtacctggtg
agggtcgcggtcaccaagatctgggtcaactgcccgcgctacatccacaagtacaagaag
ctcgagcagaacaagtacgtgccgcggcccgatcgcgagaccccgctcgccgcctggaag
cggctcgacctcgcgggcgacgtgatcagcgacgccgacaaggcccgcgtcgccaaggag
ggcaagctcgaggtctccgagtacgcggcgctggtcgcccgcggcgaggcctga

DBGET integrated database retrieval system