KEGG   Methylobacterium radiotolerans: Mrad2831_5353Help
Entry
Mrad2831_5353     CDS       T00674                                 

Definition
(GenBank) aminotransferase class V
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ACB27300
JGI: Mrad28315353
UniProt: B1LYB6
Position
5660804..5661946
Genome map
AA seq 380 aa AA seqDB search
MAFTESVAAALPCQRHLFEMPADVCYLDAAAWSPLPRAVRAAGEAGILVKSRPWDHPRTA
IPPWAERARAAAARLIGATADDIAIVGAVSHAMAVAARNLTVRPGGRLLRVADEFPSLRF
AFDRLAERQGLVMEEVPRPPDGDWTAAVAAAIARPGAPPLALATLTPLHWTDGSLIDLDR
LAPLVHHAGAALVIDATQAAGAMPVDVARWRPDFLAFPTYKWALGPYGLAFLYAAPHRQD
GAAIEENVGNRPPAVGARRYDRGELNDPVALFMAVTGLEQIAEWGVPAVAARLRGLTDRL
ADGVAGLGLTPPPASLRAPHILGLRPPAGLPTGLVDRLQRDRVYVSERSGALRISPHVWT
DGDDLARCLAALSEACQGST
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaccgaatccgtcgccgcggcgctcccgtgccagcgccacctcttcgagatg
cccgccgacgtctgctacctcgacgccgccgcgtggtcgccgctgccgcgggccgtgcgc
gcggcgggcgaggcggggatcctggtcaagagccgcccctgggaccatccccgcacggcg
atcccgccctgggccgagcgagcgcgcgcggcggcggcgcgattgatcggcgccaccgcg
gacgacatcgcgatcgtcggcgcggtcagccacgccatggcggtggccgcccgcaacctg
accgtgaggccgggcgggcgcctgctccgcgtggccgacgagttcccgtccctgcgcttc
gccttcgaccggctcgccgagcggcagggtctggtgatggaggaggttccgcgcccgccg
gacggcgactggaccgcggcggtcgcggccgcgatcgcccggccgggcgccccgccgctc
gccctcgccaccctgaccccgttgcactggaccgacggcagcctgatcgacctcgatcgg
ctcgcccccctggtccatcatgccggtgcggccctggtgatcgacgccacgcaggccgcg
ggcgccatgcccgtcgacgtcgcccgctggcgccccgactttctggccttcccgacctac
aaatgggcgctcggaccctacggcctcgccttcctgtacgccgcgccgcaccggcaggac
ggggcggccatcgaggagaatgtcgggaaccggccgccggccgtcggcgcgcgccgctac
gaccggggcgagctgaacgatccggtggcgctgttcatggcggtgaccgggctggagcag
atcgccgagtggggtgtgccggcggtcgccgcccggctgcgggggctgaccgaccgcttg
gcggacggggtcgccggcctcggcctgacgccgccgccggcctccctgcgggcaccccac
atcctcggtctgcggccgcccgcgggcctgccgacgggcctggtcgatcgcctgcagcgg
gaccgggtctacgtgagcgagcgctccggcgccctgcgcatcagcccgcacgtgtggacg
gacggggacgacctcgcgcgatgccttgccgcactgtccgaggcctgccaggggagcacc
tga

DBGET integrated database retrieval system