KEGG   Methylobacterium radiotolerans: Mrad2831_5363Help
Entry
Mrad2831_5363     CDS       T00674                                 

Definition
(GenBank) metallophosphoesterase
  KO
K09769  uncharacterized protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YmdB
Motif
Other DBs
NCBI-ProteinID: ACB27310
JGI: Mrad28315363
UniProt: B1LYC6
Position
5673508..5674326
Genome map
AA seq 272 aa AA seqDB search
MRLLFLGDVVGRSGRTVVCEHLPRLRERWRLDCVVVNGENAAGGFGISETICDELIQAGA
DAVTLGNHSFDQREAMVFIARQPRLVRPANYPPGTPGRGATVVETQGGARVLVVNVMGRV
FLDAMDDPFAAVERELTACPLGAAADAVIVDVHAEATSEKQAFGHYLDGRASLVVGTHTH
TPTADHRILPGGTAYMSDAGMCGDYDSVIGMQKDEPIRRMIQKTPGSRWEVAVGEGTLCG
IAVETDARGLATRVAALRLGPNLEETAPHFWD
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgctcttcctcggcgacgtcgtcgggcgttcgggccgcaccgtggtgtgcgag
cacctgccgcgcctccgggagcgttggcgcctcgactgcgtggtggtcaacggcgagaat
gcggccggcggcttcggcatctccgagaccatctgcgacgagctgatccaggccggcgcc
gacgcggtcaccctcggcaaccacagtttcgaccagcgcgaggcgatggtgttcatcgcc
cgccagccgcgcctcgtgcggccggcgaactatccgcccggcacgccgggccgcggcgcc
acggtggtggagacccagggcggcgcccgcgtgctcgtggtcaacgtgatgggccgcgtc
ttcctcgacgcgatggatgatcccttcgcggcggtcgagcgcgagctcaccgcctgcccc
ctcggcgcggcggcggacgcggtcatcgtcgacgtccacgccgaggcgacgagcgagaag
caggccttcggccactatctcgacggccgggcgagcctcgtcgtcgggacgcacacgcac
acgcccacggcggatcaccggatcctgcccggcggcacggcctacatgtcggatgccggc
atgtgcggcgattacgattcggtgatcggcatgcagaaggacgagccgatccgccgcatg
atccagaagacgccgggctcccgctgggaggtcgccgtcggcgaggggaccctgtgcggc
atcgcggtggagacggacgcgcgcggcctcgccacgcgggtcgcggccctccggctggga
ccgaatctcgaggagacagcgccgcatttctgggattag

DBGET integrated database retrieval system