KEGG   Methylobacterium radiotolerans: Mrad2831_5395Help
Entry
Mrad2831_5395     CDS       T00674                                 

Definition
(GenBank) metallophosphoesterase
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5704231..5704740
Genome map
AA seq 169 aa AA seqDB search
MTIFFTGDTHFGDPRALRFDHRPYPDLEAHDAGLIAAWNATVSPDDTVWHLGDFALGPSG
DRIRAILAGLNGEKHLIVGNNDGPDTLTAPGWASVRHYAELAVEGRMVVLCHYAFRTWNG
MSRGALNLHGHSHGKLKPMPKQYDVGVDPMGAAPVQLSVILTSRLRRKA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
gtgaccatcttcttcacgggcgacacccatttcggcgacccgcgggcgctgcgcttcgat
caccggccctatccggatctcgaggcccacgatgccgggctgatcgcggcctggaacgcg
acggtctcgcccgacgacacggtctggcacctcggcgatttcgccctcggaccgagcggc
gaccggatccgcgcgatcctcgccggactgaacggcgagaagcacctgattgtcggcaac
aacgacgggccggacacgctgacggcgcccggctgggcgtcggtgcggcactacgcggaa
ctcgccgtcgagggtcggatggtggtgctctgccactacgcgttccgcacctggaacggc
atgagccggggggctctcaacctccacggccacagccacggcaagctcaagccgatgccg
aagcagtacgatgtcggcgtcgatccgatgggtgcggcccccgtgcaactctcggtaatc
ctgacctcccgcctgcgccggaaggcgtga

DBGET integrated database retrieval system