KEGG   Methylobacterium radiotolerans: Mrad2831_5398Help
Entry
Mrad2831_5398     CDS       T00674                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACB27345
JGI: Mrad28315398
UniProt: B1LYG1
Position
complement(5705420..5705662)
Genome map
AA seq 80 aa AA seqDB search
MLNFVLGTVAGGLIACVLTIAAARQPEVQSRLGLIPAAPATLAAVTKSVEHDCGRRTEPA
PKIGSQEMLFNRQRFWSVAP
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacttcgttctcggaactgttgccggcggcctgatcgcctgcgtgctgaccatc
gcggcggcgcggcagcccgaagttcagtcccgactcggtctgataccggcggcgcccgcg
acgctggcggccgtcacgaagtcggtcgagcacgattgcggacgacggacggagccggcc
ccgaagatcggctcccaggagatgctgttcaaccgccagaggttttggtcggtcgcgccg
taa

DBGET integrated database retrieval system