KEGG   Methylobacterium radiotolerans: Mrad2831_5401Help
Entry
Mrad2831_5401     CDS       T00674                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K22185  
D-xylose 1-dehydrogenase [EC:1.1.1.175]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mrad2831_5401
Enzymes [BR:mrd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.175  D-xylose 1-dehydrogenase
     Mrad2831_5401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5706782..5707558
Genome map
AA seq 258 aa AA seqDB search
MAAQPDQRARYPSLAGKRVLVTGGASGIGAGLVEAFVGQGARVLFCDIADDAARAVVARL
GPGAAHAPLYRRCDLTDVDAVRALVAEADAALGGLDVLINNAGNDDRHALADVTPAYWDD
RMAVNLRHLFFAAQAAVPAMQRAGGGVILNFGSISWHLGLREMPLYQTAKAAIEGMTRAL
ARDLGRDNIRVATVVPGNVQTPRQERWYTPEGEAEIVAAQCLDGRIQPADVAALVLFLAS
DDARMCTGHPYFIDAGWR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcagccggatcagcgcgcgcggtatccgagcctcgccggcaagcgcgtcctc
gtgaccggcggcgcctcgggcatcggcgcggggctggtcgaggccttcgtcgggcagggg
gcccgcgtcctgttctgcgatatcgcggacgatgcggcccgcgccgtggtggcccgtctc
gggcccggcgccgcgcacgccccgctctaccggcgctgcgacctgaccgatgtcgacgcg
gtccgcgcgctggtcgccgaggccgacgcggccctgggcgggctcgacgtcctgatcaac
aatgccggcaacgacgaccgccacgccctcgcggacgtgacgcccgcctactgggacgac
cggatggcggtgaacctgcgccacctgttcttcgccgcccaggcggcggtcccggccatg
cagcgcgccggcggcggcgtgatcctcaacttcggatcgatcagctggcatctcgggctc
agggagatgccgctctaccagaccgccaaggcggcgatcgaggggatgacacgcgccctg
gcccgcgacctcggtcgcgacaacatccgggtggcgacggtcgtgcccggcaacgttcag
acgccccgccaggagcgatggtacacgccggagggcgaggcggagatcgtcgccgcgcaa
tgcctcgacgggcggatccagccggccgacgtcgccgcgctggtcctgttcctggcctcg
gacgacgcgcgcatgtgcaccggccacccgtacttcatcgacgcgggctggcgctga

DBGET integrated database retrieval system