KEGG   Methylobacterium radiotolerans: Mrad2831_5402Help
Entry
Mrad2831_5402     CDS       T00674                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5707631..5707861)
Genome map
AA seq 76 aa AA seqDB search
MRMTLLATAALLSLGAAAQAQTTVIERDRPAVVVDRPASESKSVTVHDHGDGCVTKTVRK
ENDMGDTKTVKKESCD
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatgaccttgctcgcgaccgccgccctgttgagcctcggcgctgccgcacaggcc
caaaccaccgtcatcgagcgcgaccgaccggccgtcgtcgtcgatcgcccggcgagcgag
tcgaagtccgtgaccgtccatgaccacggcgacggctgcgtcaccaagacggtgcgcaag
gagaacgacatgggcgatacgaagaccgtgaagaaagagagctgcgactga

DBGET integrated database retrieval system