KEGG   Methylobacterium radiotolerans: Mrad2831_5411Help
Entry
Mrad2831_5411     CDS       T00674                                 

Definition
(GenBank) hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACB27358
JGI: Mrad28315411
UniProt: B1LYH4
Position
5716070..5716261
Genome map
AA seq 63 aa AA seqDB search
MSRGIETDALPETPEAEEPRIPSAPAHPVTGEPAAFDPTDLNPPAPPTPRPASQTDSGFG
SFG
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgagggatcgagaccgacgccctgcccgagacgcccgaggccgaagagccccgg
atcccgagcgcgcctgcccaccccgtcacgggagagcccgccgccttcgacccgaccgac
ctcaacccgcccgcgccgccgacgccgcggcccgccagccagaccgattccggcttcggc
tccttcggctga

DBGET integrated database retrieval system