KEGG   Methylobacterium radiotolerans: Mrad2831_5413Help
Entry
Mrad2831_5413     CDS       T00674                                 

Definition
(GenBank) prolipoprotein diacylglyceryl transferase
  KO
K13292  phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC:2.-.-.-]
Organism
mrd  Methylobacterium radiotolerans
Brite
Enzymes [BR:mrd01000]
 2. Transferases
  2.-  
   2.-.-  
    2.-.-.-  
     Mrad2831_5413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LGT
Motif
Other DBs
NCBI-ProteinID: ACB27360
JGI: Mrad28315413
UniProt: B1LYH6
Position
complement(5717371..5718273)
Genome map
AA seq 300 aa AA seqDB search
MPLLALPFPAIDPVAIAIGPITIKWYALAYIAGLIGGWYYARRLVMADGLWGVVKRPQVA
DIDDLVVWVALGVVLGGRIGYVLFYNLPMYISDPWEILAIRNGGMSFHGGFVGAILAFVL
FARGKGLNAYTLLDIGAVVVPIGLFFGRIANFVNGELWGRVAPDFPYAIVFPSGGPLPRH
PSQLYEAATEGLLLFIVMALSVRRFGFRKPGLLGGIFVLGYALARTFCEFFREPDRQLGF
LFGDHVGPMGGGVTMGMLLCVPMMIVGLTYIVLAATGRTRPRHPVEAPAAEAARKAAVEA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcctcgccctgccctttccggccatcgatccggtggcgatcgcgatcgggccg
atcacgatcaaatggtacgcgctcgcctacatcgccggcctgatcggcggctggtactac
gcgcgccgcctcgtcatggccgacggtctctggggcgtggtgaagcgcccgcaggtcgcc
gacatcgacgacctcgtcgtctgggtggcgctcggcgtcgtgctcggcgggcggatcggc
tacgtgctgttctacaatctgccgatgtacatctccgatccgtgggagatcctggcgatc
cgcaacggcggcatgtcgttccacggcggcttcgtcggggcgatcctggccttcgtgctg
ttcgcccgcggcaagggcctcaacgcctacacgctcctcgatatcggcgccgtggtggtg
ccgatcggcctgttcttcggccggatcgccaatttcgtgaacggcgagctctggggccgg
gtcgcgccggacttcccctacgcgatcgtgttcccgagcggcgggccgctgccgcgccac
ccgagccagctctacgaggcggccaccgagggcctgctgctgttcatcgtgatggcgctc
agcgtccgccggttcggcttccgcaagccggggctcctcggcggcatcttcgtcctcggc
tacgcgctggcccggaccttctgcgagttcttccgcgagccggatcgccagctcggcttc
ctgttcggcgaccatgtcggtccgatgggcggcggcgtgaccatgggcatgctgctgtgc
gtgccgatgatgatcgtcggcctcacctacatcgtgctggccgcgaccggccggacacgt
ccccgccatcccgtcgaggcgccggcggccgaggcggcccgcaaggcggccgtcgaggcg
tga

DBGET integrated database retrieval system