KEGG   Methylobacterium radiotolerans: Mrad2831_5422Help
Entry
Mrad2831_5422     CDS       T00674                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mrd  Methylobacterium radiotolerans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5725772..5726758
Genome map
AA seq 328 aa AA seqDB search
MLITGASGFLGSALVDVFRRAGFPVRILVRASSPRRNLTWTDVEIAEGDMRDPAAVAAAM
RGQRYLIHAAADYRLWAPDMEEIVRTNRDGTRLMMRAALEAGVERVVYTSSVATIRPPAD
GVTPSDETMPLTPETAIGAYKRSKVVAERVVEEMVARDGLPAVIVNPSTPIGPRDVKPTP
TGRIIQEAALGKMPAFVDTGLNLAHVDDVAQGHLLALRRGRIGERYILGGEDVFLSQMLA
DIAGMVGRKPPTVNLPRAAVYPVAFFAQLAARVTGRQPFATIDGIRMSRYRMFFSDRKAR
AELGYTARPYREGLSDAITWFREAGYLA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatcaccggcgcgagcggtttcctcggctcagccctggtcgacgtgttccgccgg
gccggcttcccggtgcgcatcctcgtgcgcgcctcgagccctcgccgaaacctcacctgg
accgacgtggagatcgccgagggcgacatgcgcgacccggccgccgtggcggcggcgatg
cgcggccagcgctacctcatccatgccgcggccgattaccggctctgggcgccggacatg
gaggagatcgtccggaccaaccgcgacggcacgcgcctgatgatgcgtgccgccctcgag
gccggggtggagcgggtcgtctacacgtcgagcgttgcgacgatcagaccgccggccgac
ggcgtcacgccctccgacgagaccatgccgctgacgcccgagaccgcgatcggcgcctac
aagcgcagcaaggtcgtggccgagcgcgtggtcgaggagatggtcgcccgggacggcctg
ccggcggtgatcgtcaacccgtcgacgccgatcggtccccgcgacgtcaagccgacgccg
accgggcggatcatccaggaggcggcgctcggcaagatgccggccttcgtcgacaccggc
ctcaacctcgctcacgtggacgacgtggcccaggggcatctgctggcgctgcgcaggggg
cggatcggcgagcgctacatcctcggcggcgaggacgtgttcctctcgcagatgctcgcc
gacatcgccggcatggtcggccgcaagccgccgaccgtgaacctgccccgggccgccgtg
tacccggtggcgttcttcgcgcagctcgccgcccgggtcaccggcaggcagcccttcgcg
acgatcgacgggatccgcatgtcgcgctaccggatgttcttctcggaccggaaggcgcgc
gccgagctcggctacacggcccggccctaccgcgagggtctgtccgacgcgatcacgtgg
ttccgggaggcgggctacctcgcatga

DBGET integrated database retrieval system