KEGG   Methylobacterium radiotolerans: Mrad2831_5438Help
Entry
Mrad2831_5438     CDS       T00674                                 

Definition
(GenBank) ETC complex I subunit conserved region
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ACB27385
JGI: Mrad28315438
UniProt: B1LZD3
Position
complement(5745902..5746213)
Genome map
AA seq 103 aa AA seqDB search
MPSARIFRPSRDATQSGLARTKQWILEFDRTSPREIDPLMGWNGSSDMLQQVRLEFDTEE
EAVAYAKREGIAFRVEQPAKPAHRKGLSYSDNFKFNRTAPWTH
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcgcccgcatcttccgtccgtctcgggatgccacgcagtcgggcctcgcccga
accaagcagtggatcctggagttcgaccggaccagcccgcgcgagatcgatccgctgatg
gggtggaacgggtcctccgacatgctccagcaggtgcgcctcgagttcgacaccgaggaa
gaggccgtggcctacgcgaagcgcgaggggatcgcgttccgcgtcgagcagccggccaag
ccggcccaccgcaaggggctgtcgtactcggacaatttcaagttcaaccgcacggccccc
tggacgcattga

DBGET integrated database retrieval system