KEGG   Methylobacterium radiotolerans: Mrad2831_5441Help
Entry
Mrad2831_5441     CDS       T00674                                 

Definition
(GenBank) NUDIX hydrolase
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5748419..5748994
Genome map
AA seq 191 aa AA seqDB search
MTETLPALPLEVIHRGWNTFGIATLTLPDGSAVRRALEDHGQAACVLPYDPERRVALLVR
QARVGPAFWGESAEFDEAPAGGLDGDAPEATAIREAMEEAGVRLTRLEPVAHAYSMPSVS
SERLWLYLAPYGAADRVGPGGGLHAEGEQVMVVEMPLTALAEQARAGRLPDLKTLALVQA
LMLRSPELFAA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagaccctgcccgcgctgccgctggaggtgatccaccgcggctggaacaccttc
ggcatcgccaccctgacgctgccggatggcagcgccgtgcggcgggcgctggaggatcac
gggcaggccgcctgcgtgctgccgtacgatcccgagcggcgcgtggcgctgctcgtccgg
caggcgcgggtcgggcccgcgttctggggggagtcggccgagttcgacgaagccccggcc
ggcggactcgacggggacgcccccgaggcgaccgcgatccgcgaggcgatggaggaggcg
ggcgttcggttgacccggctcgagccggtcgcgcacgcctacagcatgccgagcgtgtct
tccgagcgcctctggctctacctcgcgccctacggcgccgccgaccgggtcggtcccggc
ggtgggctgcacgcggagggcgagcaggtgatggtcgtggagatgccgctgaccgcgctg
gcggaacaggcccgggccggccgcctgcccgacctcaagaccctggccctcgtccaggcc
ctgatgctccgaagccccgaactgttcgccgcatga

DBGET integrated database retrieval system