KEGG   Methylobacterium radiotolerans: Mrad2831_5443Help
Entry
Mrad2831_5443     CDS       T00674                                 

Definition
(GenBank) conserved hypothetical protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4139
Motif
Other DBs
NCBI-ProteinID: ACB27390
JGI: Mrad28315443
UniProt: B1LZD8
Position
complement(5749973..5751958)
Genome map
AA seq 661 aa AA seqDB search
MVTSHVVWAGVLLCMIAAAPPLRAASPGRIRAVTLSSGGLAEVTQVHPVDGDATIGLDAR
SEQIDDILKSLVVRDPVGTVGALRLDGLDQADETLRTMPFTADDLSGPARLLGKLQGVPI
RIQSGGRTLEGRVLGVSERNAGTESGEVAILTVLTGTGTLESVSIEDGAAVTIQDSAMAA
KIAEAIAAAGTAKVGDAHRVEVDVSGRGQREIRLTYVVAAPVWKTSYRIVDGGGGRANLQ
AWAIIENALGADWAGVDVTLSSGSPVALLQRLHRRYWRKRPEAPVMVEDVGMPDLDPGTV
APRSVARLRAPAPAAAPLPAPMARMDTRAESAEPSYDAAAATAGAAASEGDVAANFTLPH
PVDLRAGSTLSVPFIDTEIEAERVALWQPGRGIHPTAAFRIRNSATATLPAGLITLYDRE
AGYLGDARLPATPVGEQRLASFALDRKVAVQAETEPSQALTQITVVDGVARATVIAREVT
TYTIKGAPDAARSVIIEHPRREGWTLTASARDSETPTAYRLKVAVPAGGTAETRAVLEHV
QIDAYNLVDADEALLVRWAGLATDPELGGKLKTMSRARAEVAAATRTVEEIAEREAKVQA
EQERIRSNLGAVPKDSELARRYLTRMGGQEDELAKLAAARAEAESGLKASRARIRTLIAA
L
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
ttggtgacgtctcatgtcgtgtgggcgggcgttctgctgtgcatgatcgcggccgcgccg
cccctgagggcggcgtccccggggcggatccgcgccgtcaccctgtcgagcggcggcctc
gcggaagtcacccaggtccacccggtcgacggcgacgcgacgatcgggctcgacgctcgc
tccgagcagatcgacgacatcctcaagagcctcgtggtgcgggatcccgtcggcaccgtc
ggtgccctgcgcctggacgggctggatcaggccgacgagacgctgcggacgatgccgttc
accgcggacgacttgtccgggccggcacgcctcctggggaagctgcagggcgttccgatc
aggatccagagcggcgggcgcacactcgaggggcgagtgctcggcgtgtccgagcggaac
gccgggaccgagagcggcgaggtcgcgatcctgaccgtgctgaccgggacgggcacgctc
gaatccgtgtcgatcgaggacggcgccgccgtcacgatccaggactcggccatggcggcc
aagatcgccgaggcgatcgcggcggccgggacggccaaggtcggagacgcccaccgggtc
gaggtcgatgtctcggggcgtggccagcgcgagatccggctgacctacgtggtcgccgca
ccggtctggaagacgagctaccgcatcgtcgacggcggcggcggccgcgcgaacctgcag
gcctgggccatcatcgagaacgccctcggggccgactgggcaggcgtcgacgtcaccctc
tcgtccggctcgccggtggcgcttctccagcgcctgcaccggcgctactggcgcaagaga
ccggaggcgccggtgatggtcgaggatgtcggcatgccggacctcgacccaggcacggtc
gccccgaggtcggtcgcgcgcctgcgcgcccctgcgcccgccgccgcgccccttccggca
ccgatggcgcggatggacacccgggcggagtcagcggaaccgagctacgacgccgcggcc
gccaccgcgggcgccgccgccagcgagggggatgtggcggcgaacttcacgctgccgcat
ccggtcgatctccgcgccggcagcacgctgtcggtgccgttcatcgataccgagatcgag
gccgagcgggtcgccctctggcagccgggccgagggatccatccgaccgcggccttccgg
atccggaacagcgccaccgcgaccctgccggcgggcctcatcaccctctacgaccgcgag
gccggctacctgggagatgcccgcctgcccgcgacgccggtcggcgagcagcggctcgcc
agcttcgccctcgaccgcaaggtcgccgtccaggcggagaccgagccgagccaagccctg
acccagatcaccgtggtcgacggcgtggcgcgcgcgacggtgatcgcccgggaggtcacg
acctacacgatcaagggcgcgccggacgccgcccggtccgtgatcatcgagcatccccga
cgggagggctggaccctcaccgcttccgcccgcgacagcgagacccccacggcctatcgg
ctcaaggtcgcggtccccgccggcgggacggccgagacccgggccgtgctcgagcacgtc
cagatcgacgcctacaatctcgtcgacgccgacgaggcgctgctggtccggtgggccggc
ctcgccaccgacccggagctgggcggcaagctcaagaccatgtcccgggcccgcgccgag
gtcgccgcggcgacccggaccgtcgaggagatcgccgagcgcgaggcgaaggtgcaggcg
gagcaggagcgcatccgcagcaatctcggcgccgttccgaaggacagcgagctggcgcgg
cgctaccttacccgcatgggtggccaggaggacgagctggcgaagctcgccgccgcccgg
gcggaggccgagagcgggctcaaggcgtcgcgggcgcggatccggacgctgatcgcggcg
ctctga

DBGET integrated database retrieval system