KEGG   Methylobacterium radiotolerans: Mrad2831_5448Help
Entry
Mrad2831_5448     CDS       T00674                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mrd  Methylobacterium radiotolerans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5758165..5758818
Genome map
AA seq 217 aa AA seqDB search
MIDYAQARRMMVDCQLRTFDVNDNTVLDAFDTVPREAFVPKGREPFAYIDQTLNLGEADG
ETRCMPAPMVVARMIQALRVRPGVAALDVATGYGYAAAIMAQLGAQVTALESVPDLAAAA
RTRLGASAQVIEGPIADGAPEQGPFDVILINGRVEVRPQALLNQLKDDGRLICVFGPHRN
AKVTLFVRAGDAFGARPLFDASLPNLEAFAAEAGFAF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgatcgattacgcgcaggcgcggcggatgatggtcgactgccagttgcggaccttcgac
gtgaacgacaacacagtgctcgacgcgttcgacaccgtgccgcgcgaggccttcgtgccg
aagggccgcgagcccttcgcgtatatcgaccagaccctgaacctcggcgaggccgacggc
gagacacgctgcatgccggccccgatggtcgtggcccggatgatccaggccctgcgggtc
cgcccgggcgtcgccgccctcgacgtcgccaccggctacggctacgccgccgccatcatg
gcgcagctcggcgcgcaggtcacggcgctggaatcggtgcccgatctcgccgcggcggcg
cgcacccggctcggcgcctcggcccaggtgatcgagggcccgatcgccgacggcgccccc
gagcagggcccgttcgacgtcatcctgatcaacggccgcgtcgaggtccggccgcaggcg
ctgctgaaccagctcaaggacgacggccgcctgatctgcgtgttcggcccgcatcgcaac
gccaaggtcaccctcttcgtgcgcgccggcgacgcgttcggggcccgcccgctgttcgac
gcgtcgctgcccaatctggaggccttcgcggcggaagccggcttcgcgttctga

DBGET integrated database retrieval system