KEGG   Methylobacterium radiotolerans: Mrad2831_5449Help
Entry
Mrad2831_5449     CDS       T00674                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(5758853..5760319)
Genome map
AA seq 488 aa AA seqDB search
MTEPASETLAVLIVGAGFSGLAMAIRCRQAGIGPLRVIEKADGIGGTWHDNTYPGAACDI
PSHLYSLSFAPKADWSRMYAPQPEILAYLRDTAERNGLMPLIQLGTTFTGATWDAERALW
HVETDRERITARAIVAGMGGLHHPAFPDIPGRDAFAGPAFHTAAWDHSAALAGKRVGVIG
TGASAIQVVPELAAVASQLTLFQRTPPWIMPKNDHAIAERARDRYRRLPLSRRLERARLF
WLHEVRALLGFTKVSKLTGQAESLARHHLAKAVPDKALRAKLTPNYRLGCKRVLISDDYY
PALQRPNVTLETDGIARITETGVTTETGRHHELDVIVYATGFDVAATFARMHLVGRDGRS
LTEAWAGGVGAYQGITVAGFPNFFMLLGPNTGLGHNSVVSMIEIQVQHVLDCLTALGRGT
KTVEVRPEAQARFVDRLQSRMADSIWQAGGCRSWYLDATGRNSTLWPDSVMAYRRSARRA
RLRDYRLG
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcccgcgtccgagaccctggccgtcctgatcgtcggcgccggcttctcgggg
ctcgcgatggcgatccgctgccggcaggcgggaatcgggccgctgcgggtgatcgagaag
gccgacgggatcggcggcacgtggcacgacaacacctatccgggtgcggcctgcgatatc
ccctcgcacctctactcgctgtccttcgccccgaaggccgactggagccggatgtacgcg
ccgcagccggagatcctggcctacctccgggacaccgccgagcggaacgggttgatgccc
ctgatccagctcgggacgaccttcaccggagccacctgggacgcggagcgcgccctgtgg
cacgtggagaccgaccgggagcggatcacggcgcgcgcgatcgtcgcgggcatgggcggg
ctccaccatccggccttcccggacatcccgggccgcgacgcgttcgccggccccgccttc
cacacggcggcctgggatcactccgcggcgctggccggcaagcgcgtcggggtgatcggc
accggtgcgagcgcgatccaggtggtgccggaactcgccgccgtcgcgtcccagctgacg
ctgttccagcgcaccccgccctggatcatgcccaagaacgatcacgccatcgcggagcgt
gcccgggaccgctaccggcgcctgccgctcagccggcggctcgagcgggcgcggctgttc
tggctgcacgaggtgcgggcgctgctcggcttcaccaaggtctcgaagctcaccggccag
gccgaatccctcgcgcggcaccatctcgccaaggctgtccccgacaaggccctgcgggcg
aagctgacgccgaactaccggctcggctgcaagcgggtgctgatctccgacgactactac
cccgcgctccagcgcccgaacgtcaccctggagacggacggcatcgcccggatcaccgag
accggcgtgaccaccgagaccgggcggcatcacgagctcgacgtgatcgtctacgccacg
ggtttcgacgtggccgcgaccttcgcgcggatgcacctcgtcggccgcgacggccggagc
ctgaccgaggcctgggccggcggcgtgggcgcctaccagggcatcacggtcgcggggttc
ccgaacttcttcatgctgctcgggcccaataccgggctgggccacaactcggtcgtctcg
atgatcgagatccaggtgcagcacgtcctcgactgcctgacagcgctcgggcgcgggacg
aagaccgtcgaggtccggccggaggctcaggcccgattcgtcgaccggctccagagccgc
atggccgacagcatctggcaggccgggggctgccgcagctggtacctcgacgcgaccggg
cgcaacagcaccctctggcccgactcggtcatggcctatcgccggagcgcccgccgcgcc
cggctgagggattacaggctcggctga

DBGET integrated database retrieval system