KEGG   Methylobacterium radiotolerans: Mrad2831_5495Help
Entry
Mrad2831_5495     CDS       T00674                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mrad2831_5495
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrad2831_5495
   00052 Galactose metabolism
    Mrad2831_5495
   00500 Starch and sucrose metabolism
    Mrad2831_5495
   00520 Amino sugar and nucleotide sugar metabolism
    Mrad2831_5495
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mrad2831_5495
   00524 Butirosin and neomycin biosynthesis
    Mrad2831_5495
Enzymes [BR:mrd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mrad2831_5495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5808362..5809363
Genome map
AA seq 333 aa AA seqDB search
MFEFPVLVGDIGGTNARFGLIEKAGDQPRLLAHEATADHPDPSSAIRASLAKGGGPAPRA
AILAIAGRVDGPEIQLTNAHWKIAGQRIAEDFGLSSATVVNDYVPVAAGAADIEPHDLTP
VGPCPPVPGGARVVLGPGTGFGAAALVPYAAHLAIVSTEVGHTDIGPADAFEEKVWHALE
RVEDRITVETVLSGPGLSRLHAAVAHVRTGQPHEKIEPAAVTEAGLSATDPHAAETLELF
GRVLGRVCGDLALTFLATSGVYIGGGIAPRILKVLEESGFRTAFEKKAPFAEMMRRIPTS
VITVHDPAFRGLAALANEGAKFVYHGQVWRRET
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagtttccggttctggtcggcgacatcggcgggacgaacgcgcggttcggtctg
atcgagaaggccggcgaccagccccgcctcctcgcgcacgaggccaccgcagaccatccc
gatccttcgagtgcgatcagggcgtcgctggcgaagggcggcggcccggcgccgcgcgcg
gccatcctggcgatcgccggccgggtcgacgggccggagatccagctgacgaacgcgcac
tggaagatcgcgggccagcgcatcgccgaggatttcgggctctcatccgcgacggtcgtg
aacgactacgtgccggtggcggccggcgccgccgatatcgagccccacgacctcacgccg
gtcgggccctgtccgcccgtgcccggcggcgcccgcgtggtgctgggccccggaaccggc
ttcggcgcggcggcgctggtcccctacgcggcgcatctcgccatcgtgtccaccgaggtc
ggccacaccgatatcggcccggccgacgccttcgaggagaaggtctggcacgcgctggag
cgggtcgaggaccggatcaccgtggagacggtgctgtcggggccgggcctgtcgcggctc
cacgcggccgtcgcccatgtccggaccgggcagccgcacgagaagatcgagccggccgcg
gtcaccgaggccggtctcagcgccaccgatccgcacgccgccgagacgctcgagctgttc
ggccgggtgctcggacgcgtctgcggcgacctcgcgctgaccttcctggcgacgagcggc
gtctatatcggcgggggcatcgcgccccggatcctcaaggtgctcgaggagagcggtttc
cgcaccgccttcgagaagaaggcgcccttcgccgagatgatgcgccggatcccgaccagc
gtgatcaccgtccacgacccggccttccggggcctggcggccctggcgaacgagggcgcc
aagttcgtctaccacgggcaggtgtggcgcagggaaacgtga

DBGET integrated database retrieval system