KEGG   Methylobacterium radiotolerans: Mrad2831_5598Help
Entry
Mrad2831_5598     CDS       T00674                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00010  Glycolysis / Gluconeogenesis
mrd00620  Pyruvate metabolism
mrd00640  Propanoate metabolism
mrd00680  Methane metabolism
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01120  Microbial metabolism in diverse environments
mrd01130  Biosynthesis of antibiotics
mrd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrad2831_5598
   00620 Pyruvate metabolism
    Mrad2831_5598
   00640 Propanoate metabolism
    Mrad2831_5598
  Energy metabolism
   00680 Methane metabolism
    Mrad2831_5598
Enzymes [BR:mrd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mrad2831_5598
Lipid biosynthesis proteins [BR:mrd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mrad2831_5598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACB27543
JGI: Mrad28315598
UniProt: B1M0M1
Position
complement(5925285..5927231)
Genome map
AA seq 648 aa AA seqDB search
MEGKVIEVQSAWREGAHVDDAKYREMYAASVADPDAFWAEHGKRIDWMKPFSTVKNTSFE
PGKVSIKWFEDGTTNVAHNCIDRHLETRGDQTAIIWEGDNPDEAKHISYRELHAQVCRMA
NVLRNRGVGKGDRVTLYMPMIPEAAYAMLACARLGAIHAIVFGGFSPDSLASRIQGCGSK
VVITADEGLRGGRKVPLKANVDEAIKRLDADLVDHVIVVRRTGGSVAMEAGRDVYYDEAA
EQVTDECPAVAVDAEHPLFILYTSGSTGQPKGVVHTTGGYLVYASMTHEYVFDYREGDVY
WCTADVGWVTGHSYIVYGPLANGATTLMFEGIPTYPSTSRFWEVVDKHKVNIFYTAPTAI
RSLMGGGEGPVKKTSRQSLRVLGSVGEPINPEAWEWYYNVVGDRRCSIVDTWWQTETGGI
LITPLPGATALKPGSATRPFFGVKPQMVDAEGKVLEGPCEGNLCIADSWPGQMRTVYGDH
ERFEQTYFSTYPGKYFTGDGARRDADGYYWITGRVDDVINVSGHRMGTAEVESSLVAHPK
VAEAAVVGYPHNVKGQGIYAYVTLNDGEEGDDALRKELVTWVRKDIGPIASPDLIQFAPG
LPKTRSGKIMRRILRKIAEDDFSSLGDTSTLAEPAVVDDLIENRQNRG
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcaaggtgatcgaggtccaatccgcgtggcgcgagggtgcgcacgtggacgat
gccaagtaccgggagatgtacgcggcttccgtcgccgatcccgacgcgttctgggccgag
cacggcaagcgcatcgactggatgaagccgttctcgaccgtgaagaacaccagcttcgag
cccggcaaggtctcgatcaagtggttcgaggacggcacgaccaacgtcgcccacaactgc
atcgatcgccatctcgagacccggggcgaccagaccgcgatcatctgggagggcgacaac
cccgacgaggccaagcacatcagctaccgcgagctgcacgcgcaggtctgccggatggcc
aacgtgctgcgcaaccgcggcgtcggtaagggcgaccgcgtcacactctacatgccgatg
attccggaggccgcctacgcgatgctcgcctgcgcgcggctcggcgcgatccacgccatc
gtgttcggcggcttctcgccggactccctcgcctcgcgcatccagggctgcggctcgaag
gtggtgatcaccgccgacgagggcctgcgcggcggccgcaaggtgccgctgaaggccaat
gtcgacgaggcgatcaagcgcctcgacgcggacttggtcgaccacgtgatcgtcgtgcgc
cgcaccggcggcagcgtcgccatggaggcgggccgcgacgtctactacgacgaggccgcc
gagcaggtgacggacgagtgccccgccgtggcggtggatgccgagcacccgctcttcatc
ctctacacctcgggctcgaccggtcagccgaagggcgtggtgcacaccacaggcggatac
ctcgtctacgcgtcgatgacgcacgaatacgtcttcgattaccgcgagggcgacgtttac
tggtgcacggccgatgtcggctgggtcaccggccacagctacatcgtctacgggccgctc
gcgaacggcgccacgacgctgatgttcgagggcatcccgacctacccgtcgacctcccgg
ttctgggaagtggtcgacaagcacaaggtcaacatcttctacacggcaccgaccgcgatc
cgctcgctgatgggcggcggcgagggcccggtcaagaagacctcgcggcagtcgctgcgg
gttctgggctccgtcggcgagccgatcaacccggaagcctgggaatggtactacaacgtc
gtcggcgacaggcgctgctcgatcgtcgacacgtggtggcagaccgagaccggcggcatc
ctgatcacgccgctgccgggcgccaccgcgctcaagccgggctcggccacacgcccgttc
ttcggcgtgaagccccagatggtcgacgccgagggcaaggtgctggaagggccgtgcgag
ggcaatctctgcatcgccgattcctggccgggccagatgcgcacggtctacggcgaccat
gagcgcttcgagcagacctacttctcgacctatccgggcaagtacttcaccggcgacggc
gcccggcgggacgccgacggctactactggatcaccggccgagtggacgacgtcatcaac
gtctcgggtcaccgcatgggcaccgccgaggtcgagtcgtcgctggtcgcccacccgaag
gtcgccgaggcggcggtggtgggatacccgcacaacgtgaagggccagggcatctacgcc
tacgtgaccctcaacgacggcgaggagggcgacgacgccctgcgcaaggagctcgtgacc
tgggtccgcaaggacatcgggccgatcgcctcgccggacctgatccagttcgcccccggc
ctgcccaagacccgttcgggcaagatcatgcgccggatcctgcgcaagatcgccgaggac
gatttcagctcgctcggcgacacctcgacgctggccgagccggccgtcgtcgacgacctg
atcgagaaccggcagaaccggggctga

DBGET integrated database retrieval system