KEGG   Methylobacterium radiotolerans: Mrad2831_5612Help
Entry
Mrad2831_5612     CDS       T00674                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00010  Glycolysis / Gluconeogenesis
mrd00020  Citrate cycle (TCA cycle)
mrd00620  Pyruvate metabolism
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01120  Microbial metabolism in diverse environments
mrd01130  Biosynthesis of antibiotics
mrd01200  Carbon metabolism
Module
mrd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrad2831_5612
   00020 Citrate cycle (TCA cycle)
    Mrad2831_5612
   00620 Pyruvate metabolism
    Mrad2831_5612
Enzymes [BR:mrd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mrad2831_5612
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H CAT HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: ACB27557
JGI: Mrad28315612
UniProt: B1M0N5
Position
complement(5942503..5943864)
Genome map
AA seq 453 aa AA seqDB search
MSAALQIALPDIGDYRDVPVIELLVKPGDRLAVDDLILSIESDKATMEVPSPVAGIVREL
LVAVGSKVSEGTPILTVEPAEGGGAAPVPDTSPAVAASAPPDRSAAPLSRAGEGQGERSG
HSGDGAPLTPPLSRTADGVGRASSEPIQATRGDVHASPSVRQLARELGVGLDRVAATGPK
GRILREDVHAFVKAALGAPAQAPVAASGIGPGLPPWPEVDFAKYGPVRREPLSRIQSLSG
ANLSRNWLTIPHVTNFDRADVTEIESFRLGLNKETRTPPARVTMVAFLIKAAASALRAYP
RFNASLEGGDLVLKDYVHVGFAVDTPKGLMVPVVRDCDRKGLIEIATEMAAMAEKARSGT
LPGSDMQGGCFSVSSLGGIGGDGFTPIINAPEVAILGAARSRTEAVWDGKAFQPRLILPL
SLSWDHRVVDGVAAARFLGHVASVLSDLRRALL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgcgctgcagatcgcccttccggatatcggcgactaccgggacgtgccggtc
atcgagcttctggtgaagcccggcgaccgtctcgcggtggacgacctgatcctgagcatc
gagtccgacaaggccaccatggaggtcccctccccggtcgccggcatcgtgcgcgagttg
ctggtcgcggtggggtcgaaggtgtcggagggaacgccgatcctgacggtggagcccgcg
gagggcggcggggccgcaccggtgcccgacacatcgcccgctgtcgcggcctcggcgccc
cccgaccggagcgcggcgcccctctcccgtgcgggagagggacagggtgagagatcaggg
cattccggagacggcgcccccctcaccccgcccctctcccggacggcagacggagtcggt
cgcgcctcgtcggagccgattcaggcgacccgcggcgacgtgcatgccagcccgtccgtc
cgccagctcgcccgcgagctcggcgtgggtctcgaccgcgtcgccgccaccgggccgaag
gggcggatcctgcgcgaggacgtgcacgccttcgtcaaggcggccctcggtgcgccggcc
caggcgcccgtcgccgcgtccgggatcggccccggcctaccgccctggccggaggtggac
ttcgccaagtacgggccggtccggcgcgaaccgttgtcgcgcatccagagcctctcgggg
gcgaatctcagccgcaactggctgacgatcccgcacgtgaccaatttcgaccgtgccgac
gtcaccgagatcgagtcgttccggctcggcctgaacaaggagacgcgcacgccgcctgcc
cgggtcaccatggtcgccttcctgatcaaagcggcggcctcggcgctgcgcgcctacccg
cgattcaacgcctcgctcgagggcggcgacctcgtcctgaaggactacgtccatgtcggc
ttcgcggtggatacgccgaagggcctgatggtgccggtggtgcgcgactgcgaccgcaag
ggcctcatcgagatcgccaccgagatggccgcgatggccgagaaggccaggtccggaacc
cttccgggctccgacatgcagggcggctgcttctcggtctcgtcgctcggcggcatcggc
ggcgacggcttcaccccgatcatcaacgcccccgaggtcgccatcctgggcgcggcgcgc
tcccgcaccgaggcggtgtgggacggcaaagccttccagccgcgcctgatcctgccgctc
agcctctcttgggaccatcgcgtcgtggacggcgtcgccgccgcccgcttcctcggccac
gtggcgtcggtcctgtcggacctgcgccgcgccctcctgtga

DBGET integrated database retrieval system