KEGG   Methylobacterium radiotolerans: Mrad2831_5631Help
Entry
Mrad2831_5631     CDS       T00674                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mrd  Methylobacterium radiotolerans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mrad2831_5631
Enzymes [BR:mrd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mrad2831_5631
Exosome [BR:mrd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mrad2831_5631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5961514..5962572
Genome map
AA seq 352 aa AA seqDB search
MSDTLPEPRPLAVEAAREGARVEGLKITQRPRRNRKADWSRRLVREHTLTVDDLIWPMFV
IDGEGRREPVASMPGVERLSVDEIVRDAERAAKLGIPAVSFFPYTEVSLRDPTGSEALNA
NNLVCRAVRAVKRAVPEIGIMTDVALDPYTSHGHDGLMKDGAILNDETVAVLVEQSLIQA
EAGTDIIAPSDMMDGRVGAIRAGLDKAGFLDVQIMAYAAKYASAFYGPFRDAIGTKAALV
GDKRTYQMDPGNSAEALREVRLDLDEGADSVMVKPGLPYLDIIRRVRDEFQVPTFAYQVS
GEYAMIEAAARNGWLDGDRAMIEALLAFKRAGADGVLTYHAPRVAERLRNHP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaccctgccagagccgcgccctctcgccgtggaggccgcccgcgagggcgcc
cgcgtggagggtctgaagattacccagcgcccgcgccggaaccggaaggccgactggtcg
cgccgcctcgtccgcgagcacaccctgacggtcgacgacctgatctggccgatgttcgtg
atcgacggcgaggggcgccgcgagccggtcgcctcgatgccgggcgtcgagcgcctctcg
gtggacgagatcgtccgcgacgcggagcgcgccgcgaagctcggcatcccggcggtgtcg
ttctttccctacacggaggtgtcgctgcgcgacccgaccggctcggaggcgctgaacgcc
aacaacctcgtctgccgggcggtccgcgccgtgaagcgggccgtgcccgagatcgggatc
atgaccgacgtggccctcgatccttacacgagccacggtcacgacggcctgatgaaggac
ggcgcgatcctcaatgacgagaccgtggcggtcctcgtcgagcagagtctgatccaggcc
gaggccgggaccgatatcatcgccccctccgacatgatggacgggcgcgtcggcgcgatc
cgcgccggcctcgacaaggccggcttcctcgacgtgcagatcatggcgtacgcggccaag
tatgccagcgccttctacgggccgttccgcgacgcgatcggcaccaaggcggccctcgtg
ggcgacaagcgcacctaccagatggatccgggcaactcggccgaagccctgcgcgaggtc
cggctcgacctcgacgagggcgcggattccgtgatggtgaagccgggcctgccctacctc
gacatcatccgccgggtccgggacgagttccaggttccgaccttcgcctaccaggtgtcg
ggcgagtacgcgatgatcgaggcggcggcccgcaacggctggctcgacggcgaccgcgcg
atgatcgaggcgctcctcgccttcaagcgggccggggccgacggtgtgctcacctaccac
gcgccgcgggtcgcggagcgcctgcgcaaccatccgtga

DBGET integrated database retrieval system