KEGG   Meiothermus ruber DSM 1279: K649_00610Help
Entry
K649_00610        CDS       T02636                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mre00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    K649_00610
Enzymes [BR:mre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     K649_00610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(106810..107751)
Genome map
AA seq 313 aa AA seqDB search
MSIVVVGSINMDLVVRVKRHPVPGETLLGSDYETHHGGKGANQAVAAARMLARPMPTKSA
SPGPAPGVRMIGRVGQDEFGQQLRNALKREGINVSATLPIAAPTGVAFIAIDEEGQNTII
VSPGANHRLRPEHLSPAEFEEARVVVLQLEIPLETVRRAAELGRQAGAQVILNAAPAQKL
PDKLLHHIDILVVNEIEALGLSGVKPDSPEMALEVAQLLAKKVPTVIITLGEQGAVWASP
EGQGHQPVPEVEVVDATGAGDAFIGALAAALCEGRPLAQAVAHGCVAGALATTKTGAQSS
LPWREEVCARLEL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgtggtggtgggaagcatcaacatggatctggtggtgcgggtcaagcgacat
ccggttcccggcgaaaccctcctgggctcggattacgagacccatcacggcggtaaaggg
gccaaccaggccgtggccgccgcgcgcatgctggcccgccccatgcccaccaaaagcgcc
agccccggcccagcccccggggtgcgcatgattggtagggtggggcaggatgagttcggc
cagcaactgcgcaacgccctcaagcgcgaggggatcaatgtgagcgccacccttcccatc
gcggcccccaccggcgtggctttcattgcgattgatgaggaagggcagaacaccatcatc
gtctcgccgggggccaaccaccgcctacggcccgagcacctctcccccgccgagttcgag
gaggcccgggtggtggtcttgcagctcgagattcccctcgagaccgtgcgacgggcggcc
gagctgggccgccaggccggcgctcaggtcatcctgaacgctgcacctgcgcaaaaactg
cccgataaactcctacaccatatcgacatcctagtggtcaacgaaatcgaagccctgggc
ctgagcggggtcaagcccgactcacccgagatggccctcgaggtagcccagctactggct
aaaaaagtgcccaccgtcatcatcaccctgggtgaacagggagcagtgtgggcatccccc
gagggccagggacatcagccagttcccgaagtagaggtcgtcgatgccactggggccggg
gatgcctttatcggggcattggccgcagccctctgtgagggaaggcccctggcccaggcg
gtggcccacggctgtgtggccggggccctggctaccaccaaaaccggcgctcaatcctcg
ctgccctggcgcgaggaggtgtgcgcgcggctcgagctttga

DBGET integrated database retrieval system