KEGG   Meiothermus ruber DSM 1279: K649_01050Help
Entry
K649_01050        CDS       T02636                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
mre  Meiothermus ruber DSM 1279
Brite
Enzymes [BR:mre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     K649_01050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
185454..186410
Genome map
AA seq 318 aa AA seqDB search
MVWAQPGPPLRSLAEARKIQIGAAVEPSLLLQEPQYAQVLAREFNLVVAENVMKWGALQT
ARGEYNFAAADLLLNFAQRNRQAVRGHTLVWHQQLPRWMYGSFTSAEMEAILSDHIRTVV
GRYRGQIAYWDVVNEAIGDDARLRSTPFDVLPGYLEKAFRLARAADPSAKLFYNDYGAEG
LGAKSDAIYALLKELRARGVPVDGVGFQVHVDSSFSPRQVRMAENLERFAQLGLEIHITE
MDVLLSSTGSRAERLERQAQVYREVLQVCLRQPRCKVFTLWGFTDAHSWRGASEPLIFDV
DYQPKPAYFALQRTLQQP
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggtatgggcccagcccggcccgccgctgcgaagcctggccgaggctcggaaaattcag
atcggagcggctgtggaaccgagtctgctgctgcaggaaccccagtacgcccaggtgctg
gctcgggagttcaacctggtggtggccgagaacgtgatgaagtggggggccttgcagacc
gctcgaggtgagtacaactttgccgctgccgacctgcttctgaactttgcccagaggaac
cggcaggcggtgcgggggcataccctggtctggcaccagcaactgccccgctggatgtac
ggcagttttacctcggccgagatggaggccatcctgagcgatcacatccgcaccgtggtg
gggcgttaccgcggccaaatcgcctactgggacgtggtgaacgaggcgatcggcgacgat
gcccggctgcgctcgacgcccttcgatgtgctgcccggctacctggaaaaagcctttcgg
ctggcccgtgcggccgaccccagcgccaagctgttctacaacgactacggggccgagggc
ctgggggccaagtcggatgccatctacgcgcttctgaaggagctcagagcaaggggggtg
ccggtggatggggtgggcttccaggtgcacgtggactcgagcttctcccccaggcaggtg
cggatggccgagaacctcgagcgcttcgcccagctcggactggaaattcacatcaccgag
atggacgtgctgctaagtagcaccggctccagagccgaacggctcgagaggcaggcccag
gtgtaccgcgaagtgctgcaagtctgcttgcgccagccccgctgcaaggtcttcaccctg
tggggctttaccgatgcccactcctggcggggggccagcgagcccctcatcttcgacgtg
gattaccaacccaaaccggcctactttgccctccagcgcaccttacaacaaccctaa

DBGET integrated database retrieval system