KEGG   Meiothermus ruber DSM 1279: K649_01285Help
Entry
K649_01285        CDS       T02636                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mre00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    K649_01285
Enzymes [BR:mre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     K649_01285
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     K649_01285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237203..238009
Genome map
AA seq 268 aa AA seqDB search
MPELPEVETTRRILEPYLLGQRIQQLLHQDPARYRNTERAEGRRVLGTSRRGKYLIIHLD
ENLELIVHLGMTGGFRFEPHRHTRVTLHLPHQTLYYTDPRRFGKWWVVEAGDYREIDLLC
RMGPEPLSDDFTLAHFQQALRTPRKIKEVLLAQEAVAGVGNIYADESLWLSQIHPERPAA
SLSSPEVRRLYKAIRVVMERAVEAGGSTLSDASYRQPDGQPGYFQFQHNAYDRTGQPCKR
KGCTGRIAKIVVGGRGTHFCPQCQQNSR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactacccgaagtggaaaccacccggcgcatcctcgagccctacctgctgggc
cagcgcatccaacaactcctgcaccaagaccccgcccgctaccgcaacaccgagcgggcc
gaggggcgcagggtgctgggcacttcccgccggggcaagtacctgattattcacctggac
gagaacctcgagctcatcgtgcacctgggtatgaccgggggctttcgctttgagccgcac
cgccatacccgggtcaccctgcacctgccccaccaaaccctctactacaccgacccccgg
cgctttgggaagtggtgggtggtggaggcgggcgactaccgcgaaattgacctgctgtgc
cgcatggggcccgagccgctctcggacgatttcaccctcgcacacttccagcaggcactc
cgcaccccccggaaaatcaaggaggtgctgctcgcgcaagaggcggtggccggggtgggc
aacatctacgccgacgagtcgctgtggctgagccagatccaccccgagcggcctgccgcc
tcgctttcaagtcccgaagtccggcggctgtacaaggccatccgggtggtgatggagcgg
gcggtggaggctggaggttccacgctctcggatgcgagctaccggcagcccgatggccag
cccggctactttcagttccagcacaacgcctacgaccgcaccggccagccctgcaagcgc
aagggctgcacgggccggattgccaaaattgtggtgggcgggcgtggaacccacttctgc
ccgcagtgccagcaaaatagccgctag

DBGET integrated database retrieval system