KEGG   Meiothermus ruber DSM 1279: K649_01570Help
Entry
K649_01570        CDS       T02636                                 

Definition
glu/Leu/Phe/Val dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mre00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    K649_01570
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    K649_01570
   00330 Arginine and proline metabolism
    K649_01570
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    K649_01570
Enzymes [BR:mre01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     K649_01570
Exosome [BR:mre04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   K649_01570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(302725..304002)
Genome map
AA seq 425 aa AA seqDB search
MKSEPLSYLCSDNIGPWEIYLAQVDRVTPYLGKLAFWVEDLKRPKRVLIVDVPVQMDDGS
VAHFEGYRVHHNTFRGPAKGGIRYHQDVTLSEVMALAAWMTIKNAAVGLPYGGGKGGIRV
DPRKLSPGEIERLTRRYTSEIGIIIGPDKDIPAPDMGTGAREMAWMMDTYSMNVGRTAPG
VVTGKPIAVGGSLGRQDATGRGVFVTAAAAAEKIGLPVAGSRVAVQGFGNVGNAAARIFH
DHGARIVAVSDVTGGIRNDGGIDPYDLTTYVRQMGGVKGYPKAEPIPAPEVLTTPCEFLV
PAALEKQITEANAWKVQCKIVAEGANGPTTPAADDILAERGILVIPDVIANAGGVTVSYF
EWVQDFNSFFWTEDEINARLERLMRQSFEAVWQVAQDKKVTLRTAAYIVAATRVLEARSL
LGLYP
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgaacccctttcctatctttgcagcgacaatatcggcccctgggaaatctac
ctggcccaggtggatcgcgtcaccccctacctgggcaaactggctttctgggtggaggat
ctcaagcgacccaagcgcgtcctaatcgtggacgtgcccgtccagatggacgacggctcg
gtggcccactttgaaggctaccgggttcaccacaacaccttccgcggcccggccaaaggc
ggtattcgctatcaccaggacgtcaccctttccgaggtgatggccctcgcagcctggatg
accatcaagaacgccgcggtggggctgccctacgggggcggtaagggcggcatccgggta
gacccccgcaagctcagccctggcgagattgagcgcctgacccggcgctacacctccgag
attggcatcatcatcggccccgacaaggacatccccgcccccgatatgggcaccggggcc
cgcgagatggcctggatgatggacacctactccatgaacgtgggccgcaccgcgccgggg
gtggttactggcaaacctattgcggtgggtggctcgttggggcggcaggacgccaccggg
cgcggggtgtttgtgactgctgccgccgctgcagaaaaaatcgggctgcccgtggcgggt
agccgggtggcggtgcagggcttcggcaacgtgggcaacgccgccgcccgcattttccac
gaccacggggccagaattgtggcggtctcggacgtcaccggcggcatccgcaacgacggc
ggcatcgacccctacgacctcaccacctacgtccggcagatgggcggtgtgaagggctac
cccaaagccgagcccattccagcccccgaggtactcaccaccccctgcgagttcctggtt
ccggccgccctggaaaaacaaatcaccgaggccaacgcctggaaggtgcagtgcaaaatt
gtggccgagggcgccaacggccccaccacccccgccgccgacgatatcctggccgagcgc
gggattctggtgatacccgatgtcatcgccaacgccggcggcgtaacggtgagctacttc
gagtgggtacaggatttcaacagctttttctggacagaagacgagatcaacgcccggctc
gagcgccttatgcgccagtccttcgaggcggtctggcaggtggcgcaggacaaaaaagta
accctgcgcaccgccgcctacattgtggccgctacacgggtgctggaggcccgctccttg
ttgggcctgtacccgtaa

DBGET integrated database retrieval system