KEGG   Meiothermus ruber DSM 1279: K649_01570Help
Entry
K649_01570        CDS       T02636                                 

Definition
glu/Leu/Phe/Val dehydrogenase
Orthology
K00261  
glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:mre00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mre00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mre00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:mre00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(302725..304002)
Genome map
AA seq 425 aa AA seqDB search
MKSEPLSYLCSDNIGPWEIYLAQVDRVTPYLGKLAFWVEDLKRPKRVLIVDVPVQMDDGS
VAHFEGYRVHHNTFRGPAKGGIRYHQDVTLSEVMALAAWMTIKNAAVGLPYGGGKGGIRV
DPRKLSPGEIERLTRRYTSEIGIIIGPDKDIPAPDMGTGAREMAWMMDTYSMNVGRTAPG
VVTGKPIAVGGSLGRQDATGRGVFVTAAAAAEKIGLPVAGSRVAVQGFGNVGNAAARIFH
DHGARIVAVSDVTGGIRNDGGIDPYDLTTYVRQMGGVKGYPKAEPIPAPEVLTTPCEFLV
PAALEKQITEANAWKVQCKIVAEGANGPTTPAADDILAERGILVIPDVIANAGGVTVSYF
EWVQDFNSFFWTEDEINARLERLMRQSFEAVWQVAQDKKVTLRTAAYIVAATRVLEARSL
LGLYP
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgaacccctttcctatctttgcagcgacaatatcggcccctgggaaatctac
ctggcccaggtggatcgcgtcaccccctacctgggcaaactggctttctgggtggaggat
ctcaagcgacccaagcgcgtcctaatcgtggacgtgcccgtccagatggacgacggctcg
gtggcccactttgaaggctaccgggttcaccacaacaccttccgcggcccggccaaaggc
ggtattcgctatcaccaggacgtcaccctttccgaggtgatggccctcgcagcctggatg
accatcaagaacgccgcggtggggctgccctacgggggcggtaagggcggcatccgggta
gacccccgcaagctcagccctggcgagattgagcgcctgacccggcgctacacctccgag
attggcatcatcatcggccccgacaaggacatccccgcccccgatatgggcaccggggcc
cgcgagatggcctggatgatggacacctactccatgaacgtgggccgcaccgcgccgggg
gtggttactggcaaacctattgcggtgggtggctcgttggggcggcaggacgccaccggg
cgcggggtgtttgtgactgctgccgccgctgcagaaaaaatcgggctgcccgtggcgggt
agccgggtggcggtgcagggcttcggcaacgtgggcaacgccgccgcccgcattttccac
gaccacggggccagaattgtggcggtctcggacgtcaccggcggcatccgcaacgacggc
ggcatcgacccctacgacctcaccacctacgtccggcagatgggcggtgtgaagggctac
cccaaagccgagcccattccagcccccgaggtactcaccaccccctgcgagttcctggtt
ccggccgccctggaaaaacaaatcaccgaggccaacgcctggaaggtgcagtgcaaaatt
gtggccgagggcgccaacggccccaccacccccgccgccgacgatatcctggccgagcgc
gggattctggtgatacccgatgtcatcgccaacgccggcggcgtaacggtgagctacttc
gagtgggtacaggatttcaacagctttttctggacagaagacgagatcaacgcccggctc
gagcgccttatgcgccagtccttcgaggcggtctggcaggtggcgcaggacaaaaaagta
accctgcgcaccgccgcctacattgtggccgctacacgggtgctggaggcccgctccttg
ttgggcctgtacccgtaa

DBGET integrated database retrieval system