KEGG   Meiothermus ruber DSM 1279: K649_03170Help
Entry
K649_03170        CDS       T02636                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mre00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mre00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(611535..612695)
Genome map
AA seq 386 aa AA seqDB search
MYQPRPEHKFTFGLWTVGNIGRDPFGEAVRERLEPDYVVYRLAELGAYGVNLHDEDLIPR
GTPPAEREAILRRFKKALQDTGLKVPMVTANLFSDPAFKDGALTSPDPWVRAYALKKSLE
TLDLGAELGAQIYVVWPGREGAEVDATGKAPRVWAWFREALDFMAEYAEEQGYNYRFALE
PKPNEPRGDIYLPTVGSMLALIGTLKHPHRFGLNPEFAHETMAGLNFVHAVAQALEMGKL
FHIDLNDQRMSRFDQDLRFGSENLKAAFFLVDLLEASGYDGPRHFDAHALRTEDEAGVWA
FARGCMRTYLILKEKAQAFRADPEVKALLEAYYQADPEPLALLGAYSREKAQRLKQLELP
EACRSRGYALEQLDQLAVEHLLGVRG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagcccagacccgagcataagttcacctttggcctttggacggtaggcaacatc
gggcgcgacccctttggcgaggccgtgcgggaacggctcgagcccgactacgtggtgtac
aggctggccgagctgggggcctacggggtcaacctgcacgacgaagacctgatcccccgt
ggcacgcccccggccgagcgcgaggccatcctgcgccgcttcaagaaggccctgcaggac
accggcctcaaggtgcccatggtcaccgccaacctcttctccgacccggcctttaaggac
ggggccctgaccagccccgacccctgggtgcgggcctacgccctgaagaagagcctcgag
accctcgacctgggcgccgagctgggggcccagatttacgtggtctggccggggcgggag
ggggccgaggtagacgccaccggcaaggccccgcgggtatgggcctggttccgcgaggcc
ctggacttcatggccgagtatgcggaggagcagggctacaactaccgctttgccctggag
cccaaacccaacgagcctcgaggcgacatctacctgcccaccgtgggcagcatgctggcc
ctgatcggcaccctgaagcacccgcaccgctttggcctcaaccccgagttcgcccacgag
accatggccgggctcaacttcgtgcacgcggtggcccaggccctggagatgggcaagctc
ttccacatcgacctgaacgaccagcgcatgagccgcttcgaccaggatctgcgctttggc
tcggagaacctcaaggccgcgttcttcctagtggatctgctcgaggccagcggttacgac
ggcccccgccacttcgacgcccacgccctgcgcaccgaggacgaggccggggtctgggct
tttgcccggggctgtatgcgcacctacctgattctgaaggagaaagcccaggccttccgg
gccgaccccgaggtgaaggctttgctcgaggcctactaccaggccgaccccgagcctttg
gccctgctgggggcctacagccgggaaaaagctcagcggctcaagcagctcgagctgccc
gaggcctgccgcagccgcggttatgccctggagcagctcgaccagctcgccgtagagcac
ctgctgggggtacggggatga

DBGET integrated database retrieval system