KEGG   Meiothermus ruber DSM 1279: K649_05045Help
Entry
K649_05045        CDS       T02636                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mre00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    K649_05045
  Amino acid metabolism
   00330 Arginine and proline metabolism
    K649_05045
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    K649_05045
Enzymes [BR:mre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     K649_05045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1017547..1018680)
Genome map
AA seq 377 aa AA seqDB search
MHGRLPLTAQTHRRLVVKVGSAVLSGPQGRQHQLAIAAQVAALRAEGREVVLVSSGAQAT
GMQKLGLTEKPKSMPGKQALAAVGQPTLMLLWEQAFSWYDLKVAQVLLTAEDLAHRHRYL
NARQTLETLLEWGIVPIINENDTVMVEEIKFGDNDQLSALIASLVGADLLILLSDIEALY
EADPRTHPEAQPIPYVERVDAGVLRMAGDSPNRVGTGGMKSKLLAAEKAQAAGIPTLLLP
GTRPQSIAEALQGAPVGTLFAGGQRRYSGRKLWLYQLPKPQGEVVVDAGAAKALRQGGAS
LLPAGILEVRGQFGVGEAVRCLDEQGNLIGVGLVNYSAAELARIKRRKTREIEALLGYKN
TDEAIHRDYFALASELE
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgcacggtcgtcttcccctcaccgcccaaacccatcgccggctggtagtcaaggtgggc
agcgccgtcctgagcgggccccaggggcggcagcaccaactggccattgccgcccaggtg
gccgccctgcgggccgaggggcgcgaggtggtgctggtctcctcgggggcccaggccacc
ggcatgcaaaagctgggcctgaccgaaaagcccaagtccatgcccggcaaacaggccctg
gccgccgtcgggcagcccaccctcatgctcctgtgggagcaggcttttagctggtacgac
ctgaaggtggcccaggtgttgctcaccgccgaagatctggcccaccgccaccgctacctg
aacgcccggcagaccctggagacgcttttggagtggggcatcgtgcccatcatcaacgag
aacgacacggtaatggtggaggagatcaagtttggcgacaacgaccagctttcggccctg
attgcttcgctggtaggggccgatctgctgatcttgctctccgacatcgaggctttgtac
gaggccgacccccgcacccaccccgaagcccagcccatcccctacgtggagcgggtggat
gccggggtgctgcgcatggcaggcgacagtcccaaccgggtgggcaccggcgggatgaaa
agcaagctgctggccgcggaaaaagcccaggccgccgggattcccaccctgctgctgccc
ggcacccggccccagagcatcgccgaggccctgcaaggcgccccggtgggcacgctgttt
gccggggggcagcgccgctacagcggccgtaagctctggctgtaccagctccccaagccc
cagggggaggtggtggtggacgccggggcggcgaaagccttacgccagggcggggcctcg
ctcctgccggcgggcatcctcgaggtgcgcgggcagtttggggtgggcgaggcggtcagg
tgcctggacgagcagggcaacctgatcggggtgggcctggtcaactacagcgccgccgag
ctcgcccgcatcaagcgccgaaaaaccagggagatcgaggccctgctgggctacaaaaac
accgacgaggccatccaccgcgactactttgccctggcctcggagctcgagtga

DBGET integrated database retrieval system