KEGG   Meiothermus ruber DSM 1279: K649_06425Help
Entry
K649_06425        CDS       T02636                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mre00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    K649_06425
Enzymes [BR:mre01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     K649_06425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1317977..1318528
Genome map
AA seq 183 aa AA seqDB search
MFSGKSDELIRRVKRALIARQRVLVFKPRLDDRYHASDVFSHDGRRAEAIAVRDAAELRA
HLSDPLPDVVAVDEAQFFDAGLVALVLELADRGVRVICAGLDMDFRGEPFGIMPQLLARA
EYVEKLFAVCPVCGAPATRTQRFVNGKPARYDDPVILVGASEAYEPRCRKCHTVVTKEVQ
EIL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgttctccggcaagtcggatgaactgattcggcgtgtcaagcgggccctgattgcccgc
cagcgggtgctggtatttaagccgcgcctggatgaccgctaccacgcctccgatgtcttt
agccacgacggccgacgggcagaggccatcgctgtgcgcgatgccgccgagcttagggcg
cacctatccgacccgctgcccgacgtggtggccgtggatgaggcccagttttttgatgcg
ggcctggtggcgctggtgttggaactggcggataggggggtgcgggtaatttgtgctggc
ctggatatggattttcgcggtgagccgttcggcatcatgccccaattgctggcccgggcc
gagtatgtggagaagctttttgcggtgtgtccggtgtgtggggccccggcaacccgcacc
cagcgctttgtgaatggcaaaccggcccgctacgacgacccggtaattctggtcggcgcc
agcgaggcctacgagccgcgctgccgcaagtgccataccgtggtgaccaaagaagtacag
gagattctttag

DBGET integrated database retrieval system