KEGG   Meiothermus ruber DSM 1279: K649_08465Help
Entry
K649_08465        CDS       T02636                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:mre00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    K649_08465
  Lipid metabolism
   00561 Glycerolipid metabolism
    K649_08465
   00600 Sphingolipid metabolism
    K649_08465
Enzymes [BR:mre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     K649_08465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1700583..1702037)
Genome map
AA seq 484 aa AA seqDB search
MQIQGYEFSISAGRLEETLGGYLLSGKTVQIGHPFGRTLYFKHGWQSWSEAGWVSLKESP
KPILPPERRPQCDDPAYALSPVHGGSGLGGLEGHDGRMLFLGALRPGARIEADRLSLKGS
SDHETQWFLAYGEQQQVLARYTELLANTLGIRGQPPAPRVWCSWYSYYSDISESKMLQTI
AALQGLPFEVFQLDDGWQQNMGDWEPNHKFPSGMSAIALRAQSQGLTPGLWLAPFIARPS
SNLFKEHPDWFLRDEQGELVLAGTNWGGYYALDVTLPAVQDWLQRLIQKVRGWGYRYLKL
DFLFAAALPGQRHSGASREEAYREALRLIREAAGDDVYILACGAPILASLGLVDGLRIGP
DVAPYWDNEDRRVYLHDPTGPAAYNALRTSLHRLWLKPLVHTDPDVAYFRTRYNLLTPAQ
RVVLQDLALVAGFKATSDPPEWLDGDEREGLKEWLEASPSILQTGPYTFKIGEREVDFSS
WLEI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgcagattcagggctatgagttcagcatcagcgcggggcggctcgaggaaaccctgggc
ggctacctgctgagcggcaaaaccgtgcagatcgggcacccctttgggcgcacgctctac
ttcaagcacggctggcagagctggagcgaggccggctgggtgagcctgaaagagagcccc
aaacccatcctgccccccgagcgccgcccccagtgcgacgacccagcctacgccctctca
cctgtacacggcggcagcggcctggggggcctcgagggccacgacgggcggatgctcttc
ctgggggctctgcgtccgggggcgcgcatcgaggctgaccgcctgagcctcaagggctcg
agcgaccacgagacccagtggtttctggcctacggcgaacagcagcaggtgctggcccgc
tacaccgaactgctggctaacaccctggggatccggggccagccgcccgccccccgggtc
tggtgtagctggtacagctattacagcgatatctcagaaagcaagatgctgcagaccatc
gccgctttgcagggcctgccctttgaggtgttccagctcgacgatggctggcagcaaaac
atgggcgactgggagcccaaccacaagttcccctcgggcatgagcgctatcgccctgcgg
gcccagagccagggcctgacccccggcctctggctggccccctttattgcccggcccagc
tccaacctgttcaaggagcaccccgactggttcttgcgcgacgagcagggcgagctggtt
ctggcgggcaccaactggggcggctactacgcgctggacgtgaccctgccagcagtgcaa
gactggctgcagcgcctgatccagaaggtgcggggctggggctaccgctacttaaagctg
gacttcctgtttgcagcggccctgcccggtcaaaggcatagcggagcctcgagggaagag
gcctaccgcgaagcgctccgtctcatccgcgaggccgccggtgacgacgtgtacattctg
gcctgcggggcccccatcctcgcctcgctgggcttggtggacgggctgcgcattgggccg
gacgtggccccttactgggacaacgaagaccggcgggtgtacctgcacgaccccaccggc
cccgcggcctacaacgccctgcgcaccagcctgcaccgcctctggctgaagccgctggtg
cacaccgaccccgacgtggcctacttccgcacccgctacaacctgctcaccccggcccag
cgcgtggtgttgcaagacctggccctggtcgcgggcttcaaggccacctccgaccccccc
gagtggctggacggcgatgagcgggaagggctcaaggagtggctcgaggccagcccctcc
atcctccagaccggcccctacaccttcaaaattggcgagcgggaggtggatttctcgagc
tggctggagatctga

DBGET integrated database retrieval system