KEGG   Meiothermus ruber DSM 1279: K649_11945Help
Entry
K649_11945        CDS       T02636                                 

Definition
kynureninase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mre00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    K649_11945
Enzymes [BR:mre01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     K649_11945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2386347..2387576)
Genome map
AA seq 409 aa AA seqDB search
MTLAELQALDRTDPLAPKRAEFLLPEGVIYLDGNSLGALPKRVVARMEQVVQAEWGQSLI
KSWNLHGWIDLPQRVGARIARLIGAEPDEVIAADSTSVNLFKVLLAALELRPGRRVIVSD
IDNFPTDLYIAQGIAELRGGYELRFVKKDQLEEALDEQTAVLMLTEVDYRTGYLYDMARL
TRLAQQKGALTIWDLAHSAGALPVQLNRHGVDFAVGCGYKYLNGGPGAPAFLFVARRHQE
ATRPFLTGWMGHQAPFAFVPEYLPALDIRRLTVGTPGVLSMSALEAALEVFEGVEMEQVR
QKSLQLTDLFIELMEPLAARYGFQLATPREHHRRGSQVAYRHPEGYAIMQALISQGVVGD
FRAPDILRFGFTPLYLRYEDVYHAVQRLEQVMQSGLWQEARFQERAKVT
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaccttagccgagctgcaagccctcgaccgcaccgaccccctggcccccaagcgggct
gagttcctgctgcccgaaggggtcatctacctcgacggcaactcgctgggggccctgccc
aagcgggtggtggcccgcatggaacaggtggtacaggccgagtggggccagagcctgatc
aagagctggaacctgcacggctggattgacctgccccagcgggtgggggccaggatcgcc
cggctgattggggccgagcccgacgaggtcatcgccgccgactcgacctcggtcaacctg
ttcaaggtgctgctggccgccctcgagctgcgcccggggcgcagggttatcgtttcggac
atcgacaacttccccaccgacctctacatcgcccagggcatcgccgagcttcggggcggg
tacgagctgcgcttcgtaaaaaaagaccagctcgaggaggccctcgacgagcagaccgcg
gtgctgatgctgaccgaggtggactaccgcaccggctacctctacgacatggcccggctc
acccggctggcccagcagaaaggggccctgaccatctgggatctggcccatagcgcgggg
gcccttccggtgcagctcaaccggcacggggtggattttgccgtgggttgcggctacaag
tacctcaacggcggcccgggcgcgccggcttttctgttcgtggcccggcgacaccaggag
gccacccggcctttcctgaccggctggatggggcaccaggctcccttcgcttttgtaccc
gagtacctgcccgccctggatatccggcgcctgacggtggggacgcccggcgtgctctcg
atgagcgcgttggaagcggcgctcgaggtcttcgagggcgtggagatggagcaggtgcgg
caaaagtcgctacagctcaccgacctcttcatcgagctgatggagccgctggccgcccgt
tatggcttccagctcgccacaccgcgtgaacaccaccgccggggcagccaggtggcctac
cggcaccccgagggctacgcgattatgcaggccctgatcagccagggggtggtcggcgac
ttccgcgcccccgacatcctacgctttggcttcaccccgctgtacctgcgctatgaggac
gtctaccacgcagtacagcggctggaacaggttatgcaaagcgggctctggcaagaagcg
cgcttccaggaaagggccaaggtgacctga

DBGET integrated database retrieval system