KEGG   Mycobacterium rhodesiae: MycrhN_0035Help
Entry
MycrhN_0035       CDS       T01685                                 

Definition
hexose kinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MycrhN_0035
   01230 Biosynthesis of amino acids
    MycrhN_0035
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MycrhN_0035
   00030 Pentose phosphate pathway
    MycrhN_0035
   00051 Fructose and mannose metabolism
    MycrhN_0035
   00052 Galactose metabolism
    MycrhN_0035
  Energy metabolism
   00680 Methane metabolism
    MycrhN_0035
Enzymes [BR:mrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MycrhN_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42085..43038)
Genome map
AA seq 317 aa AA seqDB search
MDSIVTLTMNPALDITVAAEAVRPTSKIRCSRARYDAGGGGINVAKIAHVLGAPVSAVFP
AGGASGDMVTRLVAEAGVPFRRIDIAEPTRESFTVDETSTGLQYRFVLPGPRLTRSEQAE
CVDQLRAVATSAQFVIASGSLPPGVPTDYYQRIADVCGEVGTRFVLDTSGAGLKHVNCGV
SVLKASLRELRECVGRDLMTESEQLDAAHELVDSGRAEAVVVSLGAEGALLATPAESCRF
TAIPMRAVSGVGAGDAMVAGVTVGLTRGWPLSTAVRFGMAAGAAMLMTPGTAPCTRADTE
RLFEIAEEPVDVAVVSA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggattcgatcgtcaccctgacgatgaacccggcgctcgacatcaccgtggcagccgag
gcagtacgtcccaccagcaagatccgttgctcgcgcgcgcgttacgacgccggcggcgga
ggcatcaacgtggcgaagatcgcacatgtactcggcgcgcccgtttcggctgtcttccct
gctggaggtgccagcggcgacatggtcacccgtctcgtcgccgaggcaggcgtgcccttt
cgtcggatcgacatcgccgagcccacccgggagagtttcaccgtcgatgagacaagcaca
ggcctgcagtaccgcttcgtgcttcctggcccgcggctgactcgatccgagcaagccgaa
tgtgtggatcagctgcgtgccgtggcgacgtcggcgcaattcgttatcgccagcggaagc
ttgccgccaggtgtgcctacggactactaccagcggatcgcggatgtgtgcggtgaggtt
gggaccaggttcgtcttggacacctcaggtgccggtttgaagcacgtcaattgtggtgtg
tcggtgctcaaggcaagcctgcgcgaactccgcgaatgcgtggggcgtgacctgatgacc
gaatccgaacagcttgatgccgcacacgaactcgtcgattccggccgcgccgaggccgtc
gtggtgtcgttgggagccgagggcgcgttactcgccactcccgccgaaagctgccgattc
accgccattccgatgcgtgcggtcagtggcgtcggagcgggcgacgcgatggtcgccggc
gtcacggtgggactgactcgcggatggccgctgagcacggcggttcgtttcggcatggcc
gccggtgcggcgatgctgatgacccccggtaccgcgccgtgcacgcgcgccgataccgag
cggcttttcgagatcgccgaagagccggtggatgtcgctgtcgtatctgcatag

DBGET integrated database retrieval system