KEGG   Mycobacterium rhodesiae: MycrhN_0071Help
Entry
MycrhN_0071       CDS       T01685                                 

Definition
sulfite reductase subunit alpha (flavoprotein)
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    MycrhN_0071
  Amino acid metabolism
   00380 Tryptophan metabolism
    MycrhN_0071
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    MycrhN_0071
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     MycrhN_0071
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     MycrhN_0071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
79522..82683
Genome map
AA seq 1053 aa AA seqDB search
MAELTPSLPPQLDDVPSAVGALPTWADVVGRPYALPIDILGERHGPLFYSDHNGFRKLYA
CSAELVDELCDESRFAKNLTPTLARVRPLAGDGLFTAYYGEPNWQKAHDVLLPGFSYAGL
RNYHGAMLDISSQLIARWDARVGHALVDASTDLQKLAMDTVALAGFGARFHSFDHDGLSP
VPASFTAALGELGADSPTPRFNAEFGYLQAYFDDLIAAHTTGDPADIDDLLYVMVGRDSD
GQPVLDQQNIRNQIMTFLIAGQLTTSELMPNALYNLMHHPAVLARVEAEVDGVFGADSDY
LPGYDDIGKLSYLRQVIDETLRLSPPVLGFDRMALTDTVIGGKYPVRAGEAVTVLTGALH
RQPGWGDNVEFFDPDRFDAARSAARPSALFKPFGTGARSCIGRQFALHEATMALARVVHR
YRLIDSQHYVLQWDNALSRRPVGFCLDVVPRTPDDRRSDVLVDTADTAVRPTPAHVTAMK
KGTTLAVLFGSNLGTCRALATQLAEEATDMGCTVTVGPLVDAVGGLPDADAILIITSSYN
GQPTDDARAFLTWLTGDGAALRGNPNVAVLGVGDRNWADTYQAVPKRIDERLTELGAMPL
LPRAEADTSGDLTGTVEEFEVALWTAMAQHFGDPDAAPISDTDEPLYDLRPIEGPVTTAL
DERFMVVPMTVVQNDELVSATNALNQAKRHVRVALPDDFTYNTGDHLTVLADNPPELVDA
VLEGLGIDGAQRLAVNPRRSSRRLIALDREVSVRELLTHFVELRKPATPSQLRRLAASNA
CEPERQRLEELAEASGPCELSPVECLLEFAACQITGAELLEMLEPMTPRHYSIASSSRRS
PGVVHLIVSVLDAPARSGRGLFKGVASNHLAAISPGVPIRARVDQAREAFRAGADPEKNV
ILVSAGTGVAPFCGFLGDRLAAREADEPYSTALCFFGVRDPDVDYIFREQFERGEELGIV
RMRPAFSRAPQDGVRYVQDRIAADADEVWSLLGDPAKDTHVYVCGDGAKMAPAIRQAFLD
IYCTRTGSDESRARDWLIGLVESDRYVEDVWAG
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttaacaccttcgctgccgccgcagctcgatgacgtcccgtccgccgtaggt
gcactccccacatgggctgacgtcgtcggccgcccgtacgccctgcccatcgacattttg
ggcgagcgtcacggaccgttgttttattccgaccacaacggctttcgcaagctctatgca
tgctcagccgagttggtcgacgaactctgcgacgagagcaggttcgccaagaacctgacc
ccaacgctggcaagagttcgtccgctggcgggcgacggactgttcaccgcctactacgga
gaaccgaattggcagaaggcgcacgatgttctgttgcctgggttcagctacgccggcctg
cgcaactaccacggcgccatgctcgacatcagctcgcagctgatcgcccggtgggacgca
cgtgtgggtcacgcactggtggacgcctcgaccgatctgcagaagctggcaatggacacg
gttgccctcgcaggcttcggagcgcggtttcactcgtttgatcatgatggcctctcaccc
gttccggcgagcttcaccgccgcactcggggagctcggcgcggacagtccgacgccgcgc
ttcaatgccgaattcggctatttgcaagcatatttcgatgacctgatcgcggcgcacacc
accggcgatccggccgacatcgacgacctgctctacgtcatggtcggacgggattccgac
gggcagcctgtgctcgatcagcagaacatccgcaaccagatcatgacgttcttgatcgcc
ggacagctgacgacgtccgagctcatgcccaacgcgctctacaacttgatgcatcacccc
gctgtgcttgcgcgggtcgaagccgaagtggacggcgtcttcggcgccgacagcgattac
ctgcccggctacgacgacatcggcaagttgagctacctacggcaggtgatcgacgagacc
ctgcggctgtcgcccccggtgctcggatttgatcgaatggccctgacggacaccgtcatc
ggcgggaagtaccctgtcagggccggagaggcagtgacggtgctcaccggagcacttcac
cgccaacccggttggggtgacaacgtcgagttcttcgatccggaccggttcgacgccgcg
cgtagcgcggcgcgtccgtcggcgttgttcaagccgttcggcaccggggcgcgctcctgc
atcggacgccagttcgccctgcacgaagccaccatggcgttggcccgcgtggtacaccgg
tatcggctgatcgattcgcaacactatgtgctgcaatgggataacgcgctgagccgtcgg
ccggtcggcttctgtctcgatgttgtcccgcgcaccccggacgaccgccgatccgatgtc
ctcgtcgatacggcggatacggcggtacggccgacccctgcacacgtgacggcgatgaag
aaggggaccacgctggccgtgttgttcggttccaatctggggacgtgtcgcgcgttggcg
acacagctcgccgaggaagccaccgacatgggctgcaccgtgaccgtcgggccactcgtc
gacgcagtaggcggtctgccggacgccgacgcgatcctgatcatcacctcgtcctacaac
ggccagcccaccgacgacgcacgcgcgttcctgacctggttgacgggcgacggtgccgcc
ctgcgtggcaaccccaacgtcgcggtactcggtgtcggcgatcgaaactgggccgacacc
taccaggccgtgcccaagcgcatcgatgaacggctgacagagctgggcgcgatgccgctg
ctcccccgggccgaagccgatacgtcgggggatctcactgggacggtcgaagagttcgag
gttgccttgtggacggccatggcacagcacttcggcgatcccgacgccgcgcccatcagc
gacaccgacgaaccgctctacgacctgcgccccatcgagggaccggtcacgaccgccttg
gacgagcggttcatggtggtgccgatgaccgtcgtgcaaaacgacgaactggtcagcgcc
accaacgcgctgaatcaggccaaacgacatgtccgcgtggctcttcccgatgatttcacc
tacaacactggtgaccatctgacagtgctcgctgacaacccgcccgagcttgtcgacgcc
gtgctggagggactcggcatcgacggggcccagcggctggccgtcaacccacgacgcagc
agccgccggctgatcgccctggatcgcgaagtcagtgtgcgcgaactgctcacccatttc
gtggagctgcggaagccggccacgcccagccagttacgtcggctcgcggcatcgaatgcg
tgtgagcccgaacggcaacggctggaagagctcgccgaggcaagcggaccctgcgaactc
agtcccgtcgagtgcctgctggagttcgcagcctgccagatcaccggcgcggaattgctc
gagatgctcgagccgatgacgccgcgccattactccatcgcgtcgtcgtcgaggcgatcc
cccggcgtggtgcacctcatcgtcagcgtgctcgacgctccggcgcggtccggtcgcggt
ctgttcaagggtgtggcgtcaaaccacctcgcggccatcagtcccggagtgccgatccgg
gctcgggtggaccaggcacgggaggcttttcgcgccggcgccgaccccgaaaaaaacgtg
attctggtcagcgcgggtaccggtgtggcgccgttctgcggatttctcggcgatcggttg
gccgcgcgtgaggccgacgaaccgtattcgaccgcgttgtgcttcttcggcgtacgggac
ccggacgtcgactacatcttccgcgagcagttcgagcggggtgaagaactcggaatcgtg
cggatgcgtccggcgttctcccgcgcaccgcaggacggtgtccgctacgtgcaagaccgg
atcgccgccgacgccgacgaggtgtggagcctgctcggcgaccccgcgaaggacacgcac
gtgtacgtgtgcggcgacggcgcgaagatggcgcctgcgatacgccaggcatttctcgac
atctattgcacgcgaaccggatccgatgagagccgagctcgcgactggctgatcggcctg
gtcgagtccgaccgctacgtcgaggacgtgtgggctggttag

DBGET integrated database retrieval system