KEGG   Mycobacterium rhodesiae: MycrhN_0180Help
Entry
MycrhN_0180       CDS       T01685                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00790  Folate biosynthesis
mrh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MycrhN_0180
Enzymes [BR:mrh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MycrhN_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: AEV70826
UniProt: G8RHM4
Position
complement(185622..186218)
Genome map
AA seq 198 aa AA seqDB search
MHSSAALQLVHESPHRDPAAAEVAAAAFLRALGISLDSDSLADTPARMARGYAELFTPPP
FDLTTFPNDEGYDELVISRNLPLRSVCEHHMLSFVGIAHIGYLPGERIIGLSKLARVAEH
FACRPQRQERLTKQIADWLAEQLAHRGVGVVIEAEHSCTTLRGVHAAGSATITSALLGVL
REDPRSRQEFFALTGTNA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcattccagcgcggcattgcaactagtgcacgagtcaccacatcgggatccggccgcc
gcggaagtcgccgccgccgcattccttcgtgccctggggatttcactggattcggacagt
cttgccgacacacccgcgcggatggcgcgcggctacgctgagctattcacgccgccgccc
tttgatctgaccaccttccccaacgacgagggctacgacgaactcgtcatttcccgcaac
ctgccgctgcgatcggtgtgcgaacatcacatgttgtccttcgtcgggatcgcccacatc
gggtatctgcccggcgagcgcatcatcggactatccaagctggcccgcgtcgccgagcac
ttcgcctgccggccccaacgccaggaacggctcaccaaacaaatcgccgattggctggcc
gaacagctggcgcaccgcggggttggcgtggtcatcgaggccgagcacagctgcacgacc
ctgcgcggcgtgcacgccgccgggtcggccaccatcacctccgcactgctgggtgtcctg
cgcgaagacccccgttcacgtcaggagttcttcgcactcaccggcacgaacgcatga

DBGET integrated database retrieval system