KEGG   Mycobacterium rhodesiae: MycrhN_0264Help
Entry
MycrhN_0264       CDS       T01685                                 

Definition
fatty-acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MycrhN_0264
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MycrhN_0264
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     MycrhN_0264
Lipid biosynthesis proteins [BR:mrh01004]
 Desaturase
  First
   MycrhN_0264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(259900..260877)
Genome map
AA seq 325 aa AA seqDB search
MMLDTKTRPTAPTGRDESLARAIVQLNPKSARAKRVVALVTVGIPAIGFAVGAYMMVAGT
VTMLDYTLFAVFYAIQMFGVSIGFHRYLAHKAFKTSPFFEGVLMIAGSMALEGPILFWVS
THRRHHRYSDEEGDPHSPNLSGAGLMGKLKGLWYAHVPWMFSDQETRVAVFAPDVVRDRR
LYYYNRTYPLWALASLLLPALLGFAIGGTLTAAFSGFIFGGLARVFVANQAAWCVGSVSH
MIGSRPFATKDDSANNWPVAILTFGEGLQNNHHAFPGAYRHAMRWWEPDLSGWVIALLAK
AGIVWDLKMPDRNRINSRLRRNRTR
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcgacaccaagacgcgaccgactgctcccacgggccgggatgaatcactcgcc
cgggcgatcgtgcagctcaacccgaagagcgcacgcgccaagcgcgtcgtcgctctggtc
accgtgggaattcctgcgatcgggttcgccgtcggggcgtacatgatggtcgccggcacg
gtgaccatgctcgactacacgctcttcgcggtgttctacgcgattcaaatgttcggcgtc
agtatcggtttccaccgctacctcgcgcacaaggcgttcaagacctcgccgttcttcgag
ggcgtgctgatgatcgcgggatcgatggctctcgagggtccgatcctgttctgggtgagc
acgcaccgccggcatcaccgctactccgacgaagagggcgacccgcattcgcccaacctc
agcggtgccggtctgatgggcaagctgaaaggcctctggtatgcgcatgttccgtggatg
ttcagcgatcaggagactcgggttgccgtgttcgcacccgacgtggtccgcgatcgccgt
ctctactactacaaccggacgtatccgctatgggctctggcgagcctgctccttcccgcg
ttgctcggcttcgcgatcggcggcacgctcaccgcagcattctccgggttcatcttcggc
gggctcgcaagggtattcgtcgccaatcaggcggcgtggtgcgtcggatcggtcagccac
atgatcggctcgcggccgttcgcgacaaaggatgacagtgccaacaactggccggtcgcg
atcctcacgttcggcgagggactccagaacaaccatcacgcgttccccggtgcgtatcga
cacgcgatgcgttggtgggagccggatctcagcggctgggtgatcgccctgctggccaag
gccggaatcgtctgggatctgaaaatgcctgatcgcaacaggatcaattcccggttgcgg
cgaaaccgtactcgatga

DBGET integrated database retrieval system