KEGG   Mycobacterium rhodesiae: MycrhN_0265Help
Entry
MycrhN_0265       CDS       T01685                                 

Definition
(GenBank) fatty-acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh01040  Biosynthesis of unsaturated fatty acids
mrh01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MycrhN_0265
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     MycrhN_0265
Lipid biosynthesis proteins [BR:mrh01004]
 Desaturase
  First
   MycrhN_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-ProteinID: AEV70908
UniProt: G8RIS0
Position
complement(260874..261803)
Genome map
AA seq 309 aa AA seqDB search
MITATISQEAPTRQAQQQPQRDILAARLAYLTVGLPTLGTIGAIVYAIYNGLWVSDVVLF
AVMYVITGLGVEGGLHRYFTHRSFEASEPVKAFLAVAASMAAQGPVVFWVANHRLHHAFA
DTERDPHSPQPQGPGIRGRLKGLWHGHVGWLFQVKKIDWSRHTRDWLQDRRVMKINGQYF
TLVLLGLVIPGFIGGLVTQSVHGFVGGILWGGFARVFALDHATWVVNSLGHTIGHREFPS
RDESRNIGILAPPTMGGSWHNNHHARPSLAMTRRHWWQLDLVGEFIRLLDHAGLVSNVRY
INSDTGSDA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgatcacggccacgatttcgcaggaagcgccgacacgtcaggcgcagcaacaaccgcag
cgggacatcctcgccgcgcgtctggcgtacctcaccgtggggctgccgacgctgggtacg
atcggtgcgatcgtctacgcgatctacaacggcctctgggtatccgatgtggtgttgttc
gccgtcatgtacgtgatcacgggtctcggcgtcgagggcggactgcaccggtacttcact
caccgctcgttcgaggcgtcggaaccggtcaaggcattcctcgctgtcgccgcctcgatg
gccgcgcaaggacccgtcgtgttctgggtcgcgaaccaccgccttcatcacgcgttcgcc
gacaccgagcgcgacccgcactcgccccaaccgcagggcccgggcatacgcggccggttg
aaaggcctgtggcacggccacgttggctggttgttccaagtgaagaagatcgactggagc
cgacacacccgtgactggctgcaggaccggcgggtgatgaagatcaacggccagtacttc
actctcgtgctgctcggcctcgtgatcccgggattcatcggagggctggtgacccagtcg
gtccacgggttcgtcggcggaatcctttggggcggtttcgcccgcgtcttcgccctcgac
cacgccacgtgggtggtgaactcgctgggtcacaccatcggtcaccgcgagtttcccagc
cgcgacgagagccgcaacatcggaatcctcgcaccaccgaccatgggtgggtcatggcac
aacaaccatcacgctcggcccagtcttgcgatgacccgccggcattggtggcagctggac
ctggtcggggagttcatcaggctgctcgaccacgccggactcgtcagcaatgtccggtac
atcaactcggacacaggaagcgacgcatga

DBGET integrated database retrieval system