KEGG   Mycobacterium rhodesiae: MycrhN_0423Help
Entry
MycrhN_0423       CDS       T01685                                 

Definition
(GenBank) F420-0:gamma-glutamyl ligase
  KO
K12234  coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00680  Methane metabolism
mrh01120  Microbial metabolism in diverse environments
Module
mrh_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MycrhN_0423
Enzymes [BR:mrh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     MycrhN_0423
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     MycrhN_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F420_ligase Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AEV71063
UniProt: G8RL01
Position
440915..442255
Genome map
AA seq 446 aa AA seqDB search
MTEHGSAGAVEILPVPGLPEFRPGDDLAAAIATAAPRLQDGDILVITSKVISKCEGRIVD
APTDPEERDILRRELIDAEAVRVLARKGKTLITENAIGLVQAAAGVDGSNVDSAELALLP
TDPDGSAATLRERLREHLGVTVGVVVTDTMGRAWRNGQTDVAIGAAGLTVLHGYEGSQDR
HGNELIVTEIAVADEIAAAADLVKGKLTDIPVAVVRGLSLQDNGSGARDLVRTGEDDLFW
LGTEEAIALGRSQAQLLRRSVRAFSGEQVAPDLIEAAVAEALTAPAPHHTRPVRFVWMQD
PARRLALLDRMKAKWRTDLAGDGRTADAVEHRVKRGQILYDAPELVIPFMVPDGAHSYPD
TERTAAEHTMFTVAVGAAVQALLVALAVRGVGSCWIGSTIFAADLVRDELGLPADWEPLG
AIAIGYPEAGSGPRDPVPTDDLLVRK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacatggatctgccggcgccgtcgaaatactgccggttccaggacttcccgag
ttccggcccggcgacgatctcgctgccgccatcgctacggccgcaccccggctacaagac
ggcgacatcctggtgatcaccagcaaggtgatctccaagtgtgagggccgcatcgtcgac
gcgcctaccgaccccgaagagcgagacattctgcggcgcgagctgatcgacgcagaggcg
gtgcgggtgctcgcacgcaagggcaagacgctgatcaccgagaacgccatcgggctggtg
caggcggcggcgggggtggacggctccaatgtcgactcggcagaactcgcgctactgccc
accgacccggacggcagcgccgcgaccctgcgggagaggctgcgcgaacacctcggcgtc
acggtcggggtcgtggtgaccgacacgatgggacgggcgtggcgcaacggacagaccgac
gtcgcgatcggcgcagcgggactgacggtgctgcacggctacgaaggatcccaggatcgg
cacgggaatgagttgattgtcaccgagatcgccgtcgccgacgagatcgctgccgcggcc
gatctcgtcaagggcaagctgacggacatacctgtcgcggtggtgcggggactgtccctg
caggacaacggctccggcgcgcgtgatctcgtgcggaccggcgaggacgatctgttctgg
ctgggcaccgaggaggcgattgcgctcgggcgcagccaggcccagctgctgcggcggtcg
gtgcgcgctttcagtggcgagcaagtggcccccgatctgatcgaggccgccgtcgccgaa
gcacttaccgcaccggcgccgcatcacacccgaccggtgcggttcgtgtggatgcaggat
cctgcccgtcgactggccttgctcgaccggatgaaggcaaagtggcggacggacctggcg
ggcgatgggcgaaccgccgatgccgtcgaacaccgcgtcaaacgtggccagatcctttac
gacgcacccgaactcgtgatcccgttcatggtgcccgatggtgcgcacagctaccccgac
accgaacgcaccgccgcggagcacacgatgttcaccgtcgccgtcggtgccgcggtgcag
gctctgttggtggcgctggcggtacgtggagtgggcagctgctggatcggctccaccatc
ttcgccgccgatctggtgcgcgacgaactcggcctgcccgccgactgggagccgttgggc
gccatcgcgatcggctatcccgaagcgggttctggaccgcgcgacccggtaccgaccgat
gacctactggtgcgcaagtga

DBGET integrated database retrieval system