KEGG   Mycobacterium rhodesiae: MycrhN_0423Help
Entry
MycrhN_0423       CDS       T01685                                 

Definition
F420-0:gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mrh00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
440915..442255
Genome map
AA seq 446 aa AA seqDB search
MTEHGSAGAVEILPVPGLPEFRPGDDLAAAIATAAPRLQDGDILVITSKVISKCEGRIVD
APTDPEERDILRRELIDAEAVRVLARKGKTLITENAIGLVQAAAGVDGSNVDSAELALLP
TDPDGSAATLRERLREHLGVTVGVVVTDTMGRAWRNGQTDVAIGAAGLTVLHGYEGSQDR
HGNELIVTEIAVADEIAAAADLVKGKLTDIPVAVVRGLSLQDNGSGARDLVRTGEDDLFW
LGTEEAIALGRSQAQLLRRSVRAFSGEQVAPDLIEAAVAEALTAPAPHHTRPVRFVWMQD
PARRLALLDRMKAKWRTDLAGDGRTADAVEHRVKRGQILYDAPELVIPFMVPDGAHSYPD
TERTAAEHTMFTVAVGAAVQALLVALAVRGVGSCWIGSTIFAADLVRDELGLPADWEPLG
AIAIGYPEAGSGPRDPVPTDDLLVRK
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacatggatctgccggcgccgtcgaaatactgccggttccaggacttcccgag
ttccggcccggcgacgatctcgctgccgccatcgctacggccgcaccccggctacaagac
ggcgacatcctggtgatcaccagcaaggtgatctccaagtgtgagggccgcatcgtcgac
gcgcctaccgaccccgaagagcgagacattctgcggcgcgagctgatcgacgcagaggcg
gtgcgggtgctcgcacgcaagggcaagacgctgatcaccgagaacgccatcgggctggtg
caggcggcggcgggggtggacggctccaatgtcgactcggcagaactcgcgctactgccc
accgacccggacggcagcgccgcgaccctgcgggagaggctgcgcgaacacctcggcgtc
acggtcggggtcgtggtgaccgacacgatgggacgggcgtggcgcaacggacagaccgac
gtcgcgatcggcgcagcgggactgacggtgctgcacggctacgaaggatcccaggatcgg
cacgggaatgagttgattgtcaccgagatcgccgtcgccgacgagatcgctgccgcggcc
gatctcgtcaagggcaagctgacggacatacctgtcgcggtggtgcggggactgtccctg
caggacaacggctccggcgcgcgtgatctcgtgcggaccggcgaggacgatctgttctgg
ctgggcaccgaggaggcgattgcgctcgggcgcagccaggcccagctgctgcggcggtcg
gtgcgcgctttcagtggcgagcaagtggcccccgatctgatcgaggccgccgtcgccgaa
gcacttaccgcaccggcgccgcatcacacccgaccggtgcggttcgtgtggatgcaggat
cctgcccgtcgactggccttgctcgaccggatgaaggcaaagtggcggacggacctggcg
ggcgatgggcgaaccgccgatgccgtcgaacaccgcgtcaaacgtggccagatcctttac
gacgcacccgaactcgtgatcccgttcatggtgcccgatggtgcgcacagctaccccgac
accgaacgcaccgccgcggagcacacgatgttcaccgtcgccgtcggtgccgcggtgcag
gctctgttggtggcgctggcggtacgtggagtgggcagctgctggatcggctccaccatc
ttcgccgccgatctggtgcgcgacgaactcggcctgcccgccgactgggagccgttgggc
gccatcgcgatcggctatcccgaagcgggttctggaccgcgcgacccggtaccgaccgat
gacctactggtgcgcaagtga

DBGET integrated database retrieval system