KEGG   Mycobacterium rhodesiae: MycrhN_0498Help
Entry
MycrhN_0498       CDS       T01685                                 

Definition
(GenBank) pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00240  Pyrimidine metabolism
mrh00983  Drug metabolism - other enzymes
mrh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MycrhN_0498
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    MycrhN_0498
Enzymes [BR:mrh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MycrhN_0498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C TMP_2
Motif
Other DBs
NCBI-ProteinID: AEV71136
UniProt: G8RM38
Position
complement(514400..515791)
Genome map
AA seq 463 aa AA seqDB search
MSHLDAPGSMSHLDARGPMSHLDAPGSMSHLDAPTIIRTKRDGGALSDAAIDWVIDAYTH
GRVADAQMSALLMAIFLRGMTRPEIARWTAAMVASGERMDFTDLRRDGKPLALVDKHSTG
GVGDKVTIPLVPVVMACGGAVPQAAGRGLGHTGGTLDKLESIPGFTPELSKSRIRQQLCD
IGAAIFAAGELAPADRKIYALRDVTGTTESLPLIASSIMSKKIAEGAASLVLDCKVGSGA
FLKTEEESRELAHTLVELGTGAGLVTRVLLTDMSTPLGRTVGNAVEVTESLEVLAGGGPP
DVVELTLALAAEMLDAAGIDGADPAQTLDDGTAMDRFRELVAAQGGDVGALSDGGLPVAY
AETITAPRGGTMETIDAMAVGLAVWRLGAGRSVPGERVQSGAGLRIHRRPGEPVSAGEPL
FTLYTETPERFEAAIAELDGGFSVGDQAPPERPLIIDRITSGD
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatcttgatgctccgggttcgatgtcgcatctcgatgctcggggtccgatgtcg
catctcgatgctccgggttcgatgtcgcatctcgatgctccgacgatcatcaggaccaag
cgcgacggcggtgccctctccgatgccgcgatcgactgggtcatcgacgcctacacccac
ggccgggtggccgacgcgcagatgtcggcgttgctgatggcgatcttcttgcgcggtatg
actcggcccgagatcgctcgctggacggcggcgatggtggcctccggtgagcgcatggac
tttacagatctgcgccgcgacggaaagccattggcgttggtggacaagcattccaccggc
ggggtgggcgacaaggtcaccatcccgttggtgcccgtcgtcatggcctgcggcggcgcg
gtgccacaggcggccggccgcgggctcggccacaccggcggcaccctcgacaaactggaa
tccatcccggggttcacccctgagctgtcgaaaagtcggattcgccaacaactctgcgat
atcggcgcggcgatcttcgccgcgggtgaactggcgccggctgaccgaaagatctacgcg
ttgcgcgacgtcaccggcaccactgaatcgttgccgctgatcgcgagttcgataatgagc
aagaagatcgccgagggggcggcgtcgctggtgctcgattgcaaggtgggttccggggcg
ttcctcaagaccgaggaggagtcccgcgaactcgcgcacacgctggtcgagctcggcacc
ggagccgggctggtgacccgcgtgctgctgaccgacatgtcgacgccgctcgggcgcacg
gtgggaaatgcggtagaggtcaccgagtccctggaggtcctggccggtggaggcccaccg
gacgtggtggagctgacgctggcgttggccgctgagatgctcgacgcggcgggcatcgac
ggcgccgacccggctcagacgctcgacgacggcaccgcgatggatcggttccgcgagctc
gtcgccgcacagggcggcgatgtcggcgctctttccgacggcgggctgcccgtggcgtac
gccgagaccatcaccgccccgcgcggtggcaccatggagaccatcgacgcgatggcggtt
ggtcttgcggtgtggcggctcggtgcgggccgctccgtccccggtgaacgcgtgcaatcc
ggtgctggtctacgcatccaccgcaggccaggcgaacccgtctccgccggtgagccgctc
ttcacgctgtacaccgagacgccggagcgattcgaggccgcgatcgccgagctggacggc
ggcttcagcgtcggggaccaggcgccgccagagcgcccgctgatcatcgaccggatcacg
agcggagactga

DBGET integrated database retrieval system