KEGG   Mycobacterium rhodesiae: MycrhN_0498Help
Entry
MycrhN_0498       CDS       T01685                                 

Definition
pyrimidine-nucleoside phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mrh00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(514400..515791)
Genome map
AA seq 463 aa AA seqDB search
MSHLDAPGSMSHLDARGPMSHLDAPGSMSHLDAPTIIRTKRDGGALSDAAIDWVIDAYTH
GRVADAQMSALLMAIFLRGMTRPEIARWTAAMVASGERMDFTDLRRDGKPLALVDKHSTG
GVGDKVTIPLVPVVMACGGAVPQAAGRGLGHTGGTLDKLESIPGFTPELSKSRIRQQLCD
IGAAIFAAGELAPADRKIYALRDVTGTTESLPLIASSIMSKKIAEGAASLVLDCKVGSGA
FLKTEEESRELAHTLVELGTGAGLVTRVLLTDMSTPLGRTVGNAVEVTESLEVLAGGGPP
DVVELTLALAAEMLDAAGIDGADPAQTLDDGTAMDRFRELVAAQGGDVGALSDGGLPVAY
AETITAPRGGTMETIDAMAVGLAVWRLGAGRSVPGERVQSGAGLRIHRRPGEPVSAGEPL
FTLYTETPERFEAAIAELDGGFSVGDQAPPERPLIIDRITSGD
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcatcttgatgctccgggttcgatgtcgcatctcgatgctcggggtccgatgtcg
catctcgatgctccgggttcgatgtcgcatctcgatgctccgacgatcatcaggaccaag
cgcgacggcggtgccctctccgatgccgcgatcgactgggtcatcgacgcctacacccac
ggccgggtggccgacgcgcagatgtcggcgttgctgatggcgatcttcttgcgcggtatg
actcggcccgagatcgctcgctggacggcggcgatggtggcctccggtgagcgcatggac
tttacagatctgcgccgcgacggaaagccattggcgttggtggacaagcattccaccggc
ggggtgggcgacaaggtcaccatcccgttggtgcccgtcgtcatggcctgcggcggcgcg
gtgccacaggcggccggccgcgggctcggccacaccggcggcaccctcgacaaactggaa
tccatcccggggttcacccctgagctgtcgaaaagtcggattcgccaacaactctgcgat
atcggcgcggcgatcttcgccgcgggtgaactggcgccggctgaccgaaagatctacgcg
ttgcgcgacgtcaccggcaccactgaatcgttgccgctgatcgcgagttcgataatgagc
aagaagatcgccgagggggcggcgtcgctggtgctcgattgcaaggtgggttccggggcg
ttcctcaagaccgaggaggagtcccgcgaactcgcgcacacgctggtcgagctcggcacc
ggagccgggctggtgacccgcgtgctgctgaccgacatgtcgacgccgctcgggcgcacg
gtgggaaatgcggtagaggtcaccgagtccctggaggtcctggccggtggaggcccaccg
gacgtggtggagctgacgctggcgttggccgctgagatgctcgacgcggcgggcatcgac
ggcgccgacccggctcagacgctcgacgacggcaccgcgatggatcggttccgcgagctc
gtcgccgcacagggcggcgatgtcggcgctctttccgacggcgggctgcccgtggcgtac
gccgagaccatcaccgccccgcgcggtggcaccatggagaccatcgacgcgatggcggtt
ggtcttgcggtgtggcggctcggtgcgggccgctccgtccccggtgaacgcgtgcaatcc
ggtgctggtctacgcatccaccgcaggccaggcgaacccgtctccgccggtgagccgctc
ttcacgctgtacaccgagacgccggagcgattcgaggccgcgatcgccgagctggacggc
ggcttcagcgtcggggaccaggcgccgccagagcgcccgctgatcatcgaccggatcacg
agcggagactga

DBGET integrated database retrieval system