KEGG   Mycobacterium rhodesiae: MycrhN_0501Help
Entry
MycrhN_0501       CDS       T01685                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00020  Citrate cycle (TCA cycle)
mrh00190  Oxidative phosphorylation
mrh00650  Butanoate metabolism
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
mrh01130  Biosynthesis of antibiotics
mrh01200  Carbon metabolism
Module
mrh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mrh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mrh_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MycrhN_0501
   00650 Butanoate metabolism
    MycrhN_0501
  Energy metabolism
   00190 Oxidative phosphorylation
    MycrhN_0501
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF1691
Motif
Other DBs
NCBI-ProteinID: AEV71139
UniProt: G8RM41
Position
516931..517422
Genome map
AA seq 163 aa AA seqDB search
MSAPGSGPSGAWTPHHREGRIAPVMEKEYDRPASLDHPRAPRRPRGIPYFEKYAWLFMRF
SGVALVFLALGHLFIMLIWDGGVYRIDFNYVAQRWASPFWQIWDMALLWLAMIHGANGMR
TIIGDYARKNTTKFYLNSLLLLATGFTLVLGSYVLVTFDASIS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgcgccaggtagcgggccctcgggagcctggacgcctcatcacagggagggccga
atcgccccggtgatggagaaggaatacgaccgcccggccagcctggaccatcctcgtgcg
ccgcgtcgcccgcggggcatcccctacttcgagaaatacgcgtggctgttcatgcggttt
tctggtgtcgcgcttgtttttcttgcgctcggccacctgttcatcatgctgatctgggac
ggcggggtgtaccgcatcgacttcaactatgtcgcccagcgctgggcctcgccgttctgg
cagatctgggacatggcgctgctgtggctggccatgatccacggcgccaacggcatgcga
acgatcatcggcgactatgcccgcaagaacaccacgaagttctatctgaactcgctgctg
ttgctggcgaccggcttcaccctggtgttgggcagctacgtgctcgtcaccttcgacgcg
agcatctcatga

DBGET integrated database retrieval system