KEGG   Mycobacterium rhodesiae: MycrhN_0638Help
Entry
MycrhN_0638       CDS       T01685                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MycrhN_0638
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MycrhN_0638
Enzymes [BR:mrh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MycrhN_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
659211..659816
Genome map
AA seq 201 aa AA seqDB search
MTVRELSVPGAWEITPKVHADSRGAFYEWFTDREFTAFAGHSFDLKQANCSISAAGSLRG
LHFSQLPPSQAKYVGCPRGKVLDVVVDIRVGSPTYGRWDSVVLDDRDRRSIYISEGLGHA
FFALEDDSTVMYLCSAPYSPDREHTINALDPAIGIVWPEIEGGPILSERDRAAPTLAEVE
AAGLLPTWDETQAFVEELRRR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgacagtccgtgagctcagtgtcccgggcgcgtgggagatcacgccgaaggtgcacgcg
gattcgcgcggtgcattctacgaatggttcacggaccgtgagttcaccgcattcgccggg
cacagtttcgatctgaagcaggccaactgttcgatctctgcagccggctcgctgcgtgga
ttgcacttctcccagctgccgccgagccaggccaagtacgtcggatgcccgcgcggcaag
gtgctcgacgtcgtcgtcgacatccgcgtcggatcaccgacatacgggcggtgggactcg
gtcgtcctcgatgaccgcgaccgccggtcgatctacatctccgagggcctcgggcatgcg
ttcttcgcactggaagacgactccacggtcatgtacctgtgctcggcgccctacagcccc
gatcgcgaacacaccatcaacgcgctcgacccggcaatcggcatcgtctggccggagatc
gaaggtggaccgattctgtcagagcgggaccgcgcggcaccgaccttggcggaggtcgag
gccgccgggttgctgccgacatgggacgagacgcaggcgttcgtcgaggagttgcggcgc
cgctga

DBGET integrated database retrieval system