KEGG   Mycobacterium rhodesiae: MycrhN_0750Help
Entry
MycrhN_0750       CDS       T01685                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00010  Glycolysis / Gluconeogenesis
mrh00052  Galactose metabolism
mrh00500  Starch and sucrose metabolism
mrh00520  Amino sugar and nucleotide sugar metabolism
mrh00521  Streptomycin biosynthesis
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
mrh01130  Biosynthesis of antibiotics
mrh01200  Carbon metabolism
Module
mrh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mrh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MycrhN_0750
   00052 Galactose metabolism
    MycrhN_0750
   00500 Starch and sucrose metabolism
    MycrhN_0750
   00520 Amino sugar and nucleotide sugar metabolism
    MycrhN_0750
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MycrhN_0750
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    MycrhN_0750
Enzymes [BR:mrh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MycrhN_0750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Hydant_A_N Glucokinase
Motif
Other DBs
NCBI-ProteinID: AEV71385
UniProt: G8RQH9
Position
complement(771972..772883)
Genome map
AA seq 303 aa AA seqDB search
MGRPTLAIDIGGTKIAVGLVDDYGTLVHQAKLPTPDGDAAAIWVVIESLVTEALSRSGGA
VRGVGIASAGPIDLSAGTVSPINIVEWNRFPIVDRVSAIVDAPVRLGGDGLCMAMGERWR
GAGRGAEFMLGMVVSTGVGGGLVFDGAPYDGRTGNAGHVGHVVVDPGGRPCACGGRGCVE
TIAGGPKMTQWAREQGWDAPAGADAKELSDAAAAGDAIALRAFKRGATAVAAMIASVGAV
CDLDLVVIGGGVAKSGALLFDPLREALDSYAGLDFIRGLRVVPAELGGDAGLVGAAALAI
SAR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggcccacactcgcaatcgacatcggcggcacgaagatcgccgtcggcctcgtc
gacgactatggaacgttggtgcaccaggcgaagctgccgacccccgacggcgatgccgcg
gcgatctgggtggtcatcgaatcgcttgtcaccgaagcactctcgagatcaggaggtgcg
gtgcgcggggtaggaatcgcatccgcggggcccatcgacctctcggcaggcaccgtcagc
ccgatcaacatcgtcgagtggaaccgcttcccgatcgtcgaccgcgtgtcagcgatcgtc
gacgctccggtgcggctgggaggcgacgggctctgcatggccatgggggagcgctggcgc
ggtgcgggccgcggcgccgagttcatgctcggcatggtcgtgtcgaccggagtcggcggc
gggctggtgttcgacggtgcgccgtacgacgggcgcaccggcaacgcgggccacgtcggt
cacgtcgtcgtcgaccccggcggccggccatgcgcctgcggtggccgcgggtgcgtcgag
acgatcgcgggcggccccaagatgacgcagtgggccagagagcagggttgggatgcgccc
gccggagccgacgccaaggaactgtccgacgcggcggctgcgggtgacgccatcgcactg
cgcgccttcaagcgaggggcgacggcggtggccgcgatgatcgcgtcggtcggggcggtc
tgcgacctcgacctcgtcgtcatcggcggtggtgtcgccaaatcgggcgcactgctgttc
gaccctctccgcgaggcgctggactcctatgccgggctggacttcatccgcggcctgcgc
gtcgtgcccgctgagctcggtggcgacgcgggcctggtcggcgccgcggctctggcgatt
tcggcgcgctga

DBGET integrated database retrieval system