KEGG   Mycobacterium rhodesiae: MycrhN_0804Help
Entry
MycrhN_0804       CDS       T01685                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MycrhN_0804
Enzymes [BR:mrh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MycrhN_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
825112..826797
Genome map
AA seq 561 aa AA seqDB search
MSLEAFEELFEPADTHVARRLTAIANEPDESVALAIAVAVRALRGGSVCVDLRSIADQLE
MPDLPWPSPDDWLNAVRASPLATDKPVLRLYSDSTADLLYLDRYWLEEQQVCDDVLTLLS
STLPGAVPGLERLFPEGWEEQRAAAEIALTQSLTVLTGGPGTGKTTTVARLLALLAEQAS
LSGKPPLRIALAAPTGKAAARLLEAVQLEIDKLDAVDRDRLPELKASTLHRLLRTRPDNS
SRFRHHRENRLPHDVIVVDETSMVSLTLMARLLEALRPDSRLLLVGDPDQLASVEAGAVL
ADMVDGLGERSDVRIAALTTSHRFGKSIGALASAIRVGDADEVVSLLRAGGEHIEWLETD
EPAEHLRKVLLPHALRLREAAILGDVTAALSTLDEHRLLCAHRRGPYGVRFWNHHVERWL
ADATGEPLWTQWYAGRPVLVTANDYGLGLYNGDTGVTVVRGDGLRAVVAAGSEPIEFATG
RLPDVDTMHAMTIHKSQGSQADEVTVLLPPEDSRLLTRELFYTAVTRAKERIRVIGTEPS
VRAAVQRRAVRASGLAQRLRA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
gtgagtctcgaggcgttcgaggagctcttcgagccggccgacacccacgtcgcgcgacgg
ctcacggcgatcgccaacgagcccgacgaatcggtcgcgttggccatcgccgtcgcggtg
cgggcgctgcgcggcgggtccgtgtgcgtggatctgcggtcgatcgccgaccaactcgag
atgcccgacctgccctggccgtcgccggacgactggctgaacgcggtgcgggcgagcccc
ctcgccaccgacaagccggtgctgcgactctactcggattccaccgccgacctgctctac
ctggaccggtactggctggaagaacagcaggtgtgcgacgacgtgctgacgctgttgtcg
tcgaccctgcccggcgcggtgcccggtctcgagcggctcttccccgaaggctgggaggaa
cagcgcgcggcggcggaaatcgctctcacacagtcgcttacggtgctgaccggcgggccg
ggcacaggtaagaccacgacggtcgcgcggctgctggcgctgctggccgagcaggcgtcg
ctgtctggcaagccgccgctgcgcatcgcgctcgcggcgccgaccggtaaggcggccgcg
cggctactcgaagcggtgcagctggagatcgacaagctcgacgccgtcgatcgcgaccgg
ctgccggaattgaaggcctcgacgctgcatcggctgctgcggacacggccggacaactcg
tcgcggttccggcatcaccgcgagaaccggctgccgcacgacgtgatcgtcgtcgacgag
acgtcgatggtgtcgctgacactgatggcgcgactgctcgaagcgttgcgccccgacagc
cggctgctactggtcggcgaccccgaccagctggcctcggtcgaggcgggtgcggtgctc
gcggacatggtcgacggcctcggcgagcggtctgacgtgcgcatcgcggcgttgacgacg
tcgcaccggttcggcaagtcgatcggcgcgctggcctcggccatccgggttggtgacgcc
gatgaggtcgtctccctgctgcgggccggcggcgagcacatcgaatggctcgagaccgac
gagcccgccgagcatctgcgcaaagtgcttctcccccatgccttgcggctgcgggaagcg
gcgatcctcggcgatgtgacggccgcgctgtcgacgctggacgagcaccgactgttgtgc
gcgcaccggcgcgggccgtacggggtgcggttctggaatcaccacgtcgagcgatggctg
gccgatgcgaccggtgagccgctgtggacgcagtggtacgccggtcggcccgtgctggtg
accgccaacgactacgggttgggtctgtacaacggagacaccggcgtgacggtcgtgcgc
ggcgacgggctgcgcgccgtcgtggccgccgggtccgaaccgatcgagttcgcgaccggg
cggctccccgacgtcgacacgatgcacgccatgacgatccacaagtcgcagggcagtcag
gccgacgaggtgaccgtgttgctgccgcccgaggattcgcgcctgctgacccgcgagctg
ttctataccgcggtgacgcgcgccaaggagaggatccgcgtcatcgggaccgaaccgtcg
gtacgcgcggcggtgcagcggcgagcggtccgagcgtccgggctggcgcagcgcctgcgg
gcctag

DBGET integrated database retrieval system