KEGG   Mycobacterium rhodesiae: MycrhN_1102Help
Entry
MycrhN_1102       CDS       T01685                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00860  Porphyrin and chlorophyll metabolism
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
Module
mrh_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MycrhN_1102
Enzymes [BR:mrh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     MycrhN_1102
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MycrhN_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase T_hemolysin
Motif
Other DBs
NCBI-ProteinID: AEV71727
UniProt: G8RV46
Position
complement(1124297..1125994)
Genome map
AA seq 565 aa AA seqDB search
MTAQGSGRGRKPRPGRITFVGSGPGDPGLLTTRARTVLANAALVFTDPDVPEAVLVLAGS
ELPPPSGPEKPALAPTAVGEVAKPADDDQDGAQADTATAILPGGPDVRPALGDPAEVAKT
LAAEARTGVDVVRLVAGDPLSVDAVITEVTALAKTHLDFEIVPGLPDTTAVPTYAGLPLG
SAHTVADVRGDVDWESLAAAPGPLILHATASHLPESARTLIDHGLADTTPIVVTANGTTC
QQRSVQTTLAGLLDKATLAGAEPAGPFSGPLVVTIGKTVANRAKLNWWESRALYGWTVLV
PRTKDQAGEMSEKLVSHGALPIEVPTIAVEPPRSPAQMERAVKGLVDGRFQWVVFTSTNA
VRAVWEKFNEFGLDARAFSGVKIACVGQATADRVRAFGINPELVPVGEQSSLGLLDEFPP
YDDVFDPVNRVLLPRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPAQTREMIKTGG
FDAVCFTSSSTVRNLVGIAGKPHARTIVACIGPKTAETAAEFGLRVDVQPEVAAVGPLVE
ALAEHAARLRAEGALPPPRKKSRRR
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgacagcccaagggagcgggcgcgggcgcaagcccaggccgggccgcatcacgttcgtc
ggttcaggccccggtgaccccggcctgctgacgacgcgggcccgcaccgtgctagccaat
gccgccctggtgttcaccgaccccgacgtgcccgaagcggtgctcgtcctggcgggctcc
gaactgccgccgccgtcgggacctgagaaacccgccttggcccccacggcagtaggggag
gtcgccaagccggccgacgacgaccaggacggcgcgcaggccgataccgcgaccgccatc
ctcccgggcggccccgatgtccgtcccgcactgggtgatccggccgaggtcgccaagacg
ctcgcggcggaggcccgtaccggcgtcgacgtcgtgcgtctggtcgcaggcgatcccctg
tcggtggacgcggtgatcaccgaggtgacggcgctcgccaaaacacacctggatttcgag
atcgtgccgggcctgcccgacaccacggcggtgcccacgtatgcgggccttccgctgggc
tcagcgcacaccgtcgccgacgtccggggtgacgtggattgggagtcgctggccgccgcg
cccggcccgctgatcctgcacgccaccgcgtctcatctgcccgagtccgcgcgcacgttg
atcgaccacgggctggccgacaccacgcccatcgtggtgaccgcgaacggcacgacgtgc
caacagcgttcggtgcagaccacgctcgccggcctgctcgacaaggccacgctggccggc
gccgaaccggccggtcccttctccggcccgctggtcgtcacgatcggcaagaccgttgcc
aaccgcgccaagctgaactggtgggaaagccgcgcactgtacggctggaccgtgttggtg
ccgcgaaccaaggaccaggccggcgagatgagcgagaagctggtgtcccacggcgcattg
ccgatcgaggtgccgacgatcgccgtcgaaccgccacgcagccccgcgcagatggagcgc
gcggtcaagggtctcgtggacggccgcttccagtgggtggtgttcacctccacgaatgcc
gttcgtgcagtgtgggagaagttcaacgagttcggcctcgacgcccgcgcgttctccggt
gtgaagatcgcctgcgtcggtcaggcgaccgccgaccgggtgcgggccttcggtatcaac
cccgagctggtgccggtgggcgagcagtcctcgctcggtctgctcgacgagttcccgccg
tacgacgacgttttcgatccggtcaaccgcgtgctgctgccccgtgccgacatcgccacc
gagaccctggccgagggcctgcgtgaacgcggctgggagatcgaggacgtcaccgcgtac
cgcacagtgcgcgcggcaccgccgccggcgcagacgcgagagatgatcaagacgggcgga
ttcgacgccgtgtgcttcacctcgagttcgacggtgcgcaacctcgtcggtatcgcgggt
aagccgcacgcgcgcacgatcgtggcgtgcatcggccccaagaccgcggaaaccgcagca
gaattcgggctgcgcgtcgacgtacagcccgaggtcgccgcagtgggaccgcttgtcgag
gcgctcgcagagcacgcggcgcgattgcgtgccgaaggcgcactgccaccgcctcgtaag
aagagccggcgccgctag

DBGET integrated database retrieval system