KEGG   Mycobacterium rhodesiae: MycrhN_1121Help
Entry
MycrhN_1121       CDS       T01685                                 

Definition
(RefSeq) phosphoglycerate mutase, BPG-dependent, family 1
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MycrhN_1121
   01230 Biosynthesis of amino acids
    MycrhN_1121
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MycrhN_1121
  Energy metabolism
   00680 Methane metabolism
    MycrhN_1121
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MycrhN_1121
Enzymes [BR:mrh01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MycrhN_1121
Exosome [BR:mrh04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MycrhN_1121
  Exosomal proteins of melanoma cells
   MycrhN_1121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1141233..1141979)
Genome map
AA seq 248 aa AA seqDB search
MGDSTLILLRHGESEWNAKNLFTGWVDVDLTDKGRAEALRAGELISALDRQPDVLYTSLL
RRAITTANLALDAADRHWIPVHRDWRLNERHYGALQGLNKAETKDKYGEEQFMAWRRSYD
TPPPPIEAGSTYSQDRDPRYADIGGGPLTECLKDVVERFVPYFEGTIVPDLQAGKTVLIA
AHGNSLRALVKYLDQMSDDDVVGLNIPTGIPLRYDLDSDLKPKVAGGTYLDPEAAAAGAA
AVAAQGAK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggagactccacgctgatcctgctccgtcacggcgagagtgagtggaacgcgaagaac
ctgttcaccggttgggtagacgtcgacctcaccgacaagggcagggccgaggcgttgcgc
gcgggcgaattgatctccgctctcgaccgccagcccgacgtgctgtacacgtcactgctg
cgccgggcgatcaccacggcgaacctggcactcgacgcggccgaccggcactggattccg
gtgcaccgggactggcggctcaatgagcgccactacggcgcgctgcagggcctgaacaag
gccgagacgaaggacaagtacggcgaggaacagttcatggcttggcggcgcagttacgac
acgccgccgccgccgatcgaggcaggcagcacgtacagccaggaccgcgacccgcgctat
gccgatatcggtggggggccgctgaccgaatgcctcaaggacgtcgtcgagcggtttgtg
ccgtatttcgagggcacgatcgtgcccgatctgcaggcgggtaagaccgtgctgatcgca
gcacacggcaactcgctgcgggcgctggtgaagtatctggatcaaatgtccgatgacgac
gtggtcggcctgaacatccccaccggcatcccgcttcgctatgacctggactccgacctc
aagcccaaggtcgccggcggcacctacctggaccccgaggccgcggccgcaggggcggcc
gcggtcgctgcacagggtgcgaagtag

DBGET integrated database retrieval system