KEGG   Mycobacterium rhodesiae: MycrhN_1160Help
Entry
MycrhN_1160       CDS       T01685                                 

Definition
arginase family hydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mrh00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1178800..1179948
Genome map
AA seq 382 aa AA seqDB search
MSDRPDPSLPNAEGAWAQQAEARLPDRREREEIERGLTYGLEAAPTINDRRISTFVRGEL
PHFAGERGTFLKCPFVEDVNQVDDAEVAIFGVPLDAGATYRPGTRFGPQGIRRSTNLFGT
YNYESGVDLREQLNMVDIGDVFTIPGNLEKSFDQISQAMAHVVSKGVMPVVLGGDHSIGF
PTIRGMTPYLDGNVGIIHFDRHVDTQESDLDERMHTTPWFHATNIKNAPATNLVQIGIGG
WQAPRAGVKVGRERQSTVITVGDVERVGIEKIAEMALEIAWKDAKAVYLSFDIDVIDAGF
VPGTGWPEPGGLLPREALNLVKMISEPGLAGIEVVECSPPYDWAEQTALLSSRVILDSLA
AQVRSGKLGNKAASADRVAWGP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccggccagatccgtcgctgcccaacgccgagggcgcatgggcccagcaggcc
gaggcccgcctgccggatcgccgcgaacgcgaggagatcgaacgcggcttgacctacggg
ctcgaggcggcgccgacgatcaacgaccgccggatctccacgttcgttcgcggcgaactg
ccgcacttcgccggtgaacgcggaacgtttctgaaatgtccgttcgtcgaggacgtgaac
caggtcgatgacgccgaggtggccatcttcggtgtgcccctcgacgcaggcgcgacctac
cggcccggcacccgcttcggcccgcagggaatccggcggtccaccaaccttttcggcacc
tacaactacgagtcgggcgtcgatctgcgtgagcagctcaacatggtcgacatcggcgac
gtgttcacaatccccggcaacctggagaagtctttcgaccagatcagtcaggcgatggcg
cacgtcgtgtcgaagggggtcatgccggtcgtcctcggcggcgatcactcgatcggcttc
cccaccatccgcggcatgacgccgtatctggacggcaacgtcggcatcatccacttcgac
cgccacgtcgacacccaggagtccgatctcgacgagcggatgcacaccaccccgtggttc
cacgccaccaacatcaagaacgcgcctgcgaccaacctggtgcagatcggcatcggcggg
tggcaggcgccgcgggcgggcgtcaaggtcggccgggaacgtcaatcgacggtcatcacc
gtcggcgacgtcgaacgggtcggcatcgagaagatcgccgagatggctctcgagatcgcc
tggaaggacgccaaggcggtgtacctgtccttcgacatcgacgtcatcgacgcgggcttc
gtacccggcaccggctggcccgagcccggcgggctgctgccccgcgaggcgctgaacctc
gtcaagatgatctccgagcccggcttggccggcatcgaggtcgtcgaatgctcaccgccg
tacgactgggcggagcagacggcgctgctgagttcccgcgtgatcctcgacagcctggcc
gcccaggtgcgatcggggaagctcggcaacaaggcagcgtcggccgaccgcgtcgcctgg
ggtccgtag

DBGET integrated database retrieval system