KEGG   Mycobacterium rhodesiae: MycrhN_1176Help
Entry
MycrhN_1176       CDS       T01685                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00630  Glyoxylate and dicarboxylate metabolism
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
mrh01200  Carbon metabolism
Module
mrh_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MycrhN_1176
Enzymes [BR:mrh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     MycrhN_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AEV71799
UniProt: G8RW58
Position
complement(1193138..1194424)
Genome map
AA seq 428 aa AA seqDB search
MSTVGQPKSPEEIQKDWDTNPRWKGITRTYTPADVVALQGSVVEEATLARRGAEVLWNQL
HDMEFVNSLGALTGNMAVQQVRAGLKAIYLSGWQVAGDANLSGHTYPDQSLYPANSVPQV
IRRINNALLRADEIAKVEGDTSVENWLAPIVADGEAGFGGALNVYELQKAMIAAGVAGSH
WEDQLASEKKCGHLGGKVLIPTQQHIRTLTSARLAADVADVPTVVIARTDAEAATLITSD
VDERDRPFITGERTKEGFYRVRNGLEPCIARAKAYAPYSDLIWMETGTPDLELAAKFAEG
VKSEFPDQMLAYNCSPSFNWKKHLDDATIAKFQKELGAMGFKFQFITLAGFHALNYSMFD
LAYGYARNQMSAYVELQEREFDAEERGYTATKHQREVGAGYFDRIATTVDPTSSTTALAG
STEEGQFH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgtcggtcagccgaagtcacccgaagagatccagaaggattgggacaccaac
ccccgctggaagggcatcacccgcacctacacgccggctgacgtcgtcgcgctgcagggt
tccgtcgtcgaggaggccacgctggcccgccgcggtgccgaggtgctgtggaaccagctg
catgacatggagttcgtgaattcgctcggcgcgctcaccggcaacatggctgtccagcag
gtgcgcgccggcctgaaggccatctacctgtccggttggcaggtcgccggtgacgcgaac
ctctccggtcacacctaccccgaccagagcctctatccggccaactcggtgccgcaggtg
atccgccgcatcaacaacgcgctgctgcgtgccgatgagatcgccaaggtcgagggcgac
acgtccgtcgagaactggctcgcgccgatcgtcgccgacggtgaggccggattcggtggc
gcactgaacgtctacgagctgcagaaggcgatgatcgccgcaggcgtcgcggggtcgcac
tgggaagatcagctggcttcggagaagaagtgcggccacctcggtggcaaggtgctgatc
cccacccagcagcacatccgcacgctgacttcggctcgcctggcagccgacgtcgccgac
gtgccgacggtcgtcatcgcgcgtaccgatgccgaggccgccacgctcatcacctccgat
gtcgacgagcgggaccgcccgttcatcaccggtgagcgcaccaaggaaggcttctaccgg
gtacgcaacggcctggagccgtgcatcgcccgcgccaaggcctacgcgccgtactccgac
ctgatctggatggagaccggcaccccggacctcgagctggccgcgaagttcgccgagggc
gtcaagagcgagttcccggaccagatgctggcctacaactgctcgccgtcgttcaactgg
aagaagcacctcgacgacgcgacgatcgcgaagttccagaaggagctcggcgcgatgggc
ttcaagttccagttcatcacgctggctggcttccacgccctgaactactcgatgttcgat
ctggcctacggctacgcccgtaaccagatgagcgcctacgtcgagctgcaggagcgcgag
ttcgacgccgaggagcggggttacaccgcgacgaagcaccagcgcgaggtcggcgccggt
tacttcgaccggatcgccaccaccgtcgatccgaccagttcgaccaccgcgctggcgggc
tcgaccgaagagggccagttccactga

DBGET integrated database retrieval system