KEGG   Mycobacterium rhodesiae: MycrhN_1460Help
Entry
MycrhN_1460       CDS       T01685                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mrh00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1489186..1490334
Genome map
AA seq 382 aa AA seqDB search
MSEPDWAPLTGFRVAVTSARRAEELGALLERRGATVTSAAAITMVPLPDDDALRAHTEAL
IDVPPDIVIATTGIGFRGWVAAADGWGLAADLIAALSQARIVSRGPKATGALRAAGLPEE
WSPESESSRELLHYLVDGGIDGARIAVQLHGATEDWDPYPEFLDELRAAGADVVPIRVYR
WRPPPHGGDFDQLVAGIAEEKFDAVSFTSAPAVASVLMRAMEMGIEDRVLTALRTNVHAM
CVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLCARTMQVAGHLLEIRGTCVLV
DGTVKTVSPAGMATIRALAHHPGAVVSRNALLTALPGSGTDTHAVETAVLRLRTALGDKN
IVSTVVKRGYRLAVDEDLVHAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcctgactgggcaccgctcaccggcttccgggtggcggtgacttccgctcgc
cgtgccgaggaactgggcgcgctgcttgaacgccgcggcgccacggtgacgagcgcggcc
gcgatcaccatggtgccgcttccggatgacgatgcgttgcgcgcgcacacggaggcgctg
atcgacgtaccgcccgacatcgtgatcgcgaccactggcatcggattccgcggctgggtc
gcggcggccgacggctgggggttggccgccgacctgatcgccgcgctgagccaggcgcgc
atcgtgtcgcgcggtccgaaagccaccggcgcgctgcgcgccgcggggttgcccgaagaa
tggtcgcccgaatcggagtcgtcgcgcgagttgttgcactacctcgtggatggcggcatc
gacggagcgcggatcgcggtgcagctgcacggcgcgaccgaggactgggacccgtacccg
gagttcctcgatgagttgcgtgccgcgggcgccgacgtggtaccgatccgggtctaccgc
tggcgtccaccgccgcacggcggagacttcgaccaactcgtggccgggatcgcggaggag
aagttcgacgcggtgagtttcacctccgcgccggccgtcgcctcggtgttgatgcgggcg
atggagatgggaatcgaggaccgggtcctcaccgcgctgcgcaccaatgtgcacgccatg
tgcgtcgggccggtcacggcgcggccgctggtccggctcggcgtgccgacgtccgcaccg
gaacgcatgcggctgggtgccctggcccggcacatcaccgatgagctgccgctgttgtgc
gcgcgcacgatgcaggtggccggtcatctcttggagatccgcgggacctgcgtgctggtc
gacggcacggtcaagacggtgtcgccggcgggaatggccaccatccgggcgctcgcgcat
catcccggcgcggtggtgtcacgcaacgcgctgctgacggcgctgcccggtagcggcacc
gacacgcacgccgtcgagaccgcggtgttacggctccgaaccgcgttgggcgacaagaac
atcgtgtcaacggtcgtcaagcgcggctatcggctggcagtcgatgaagacttggtgcac
gctctatga

DBGET integrated database retrieval system