KEGG   Mycobacterium rhodesiae: MycrhN_1460Help
Entry
MycrhN_1460       CDS       T01685                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mrh  Mycobacterium rhodesiae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MycrhN_1460
Enzymes [BR:mrh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MycrhN_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1489186..1490334
Genome map
AA seq 382 aa AA seqDB search
MSEPDWAPLTGFRVAVTSARRAEELGALLERRGATVTSAAAITMVPLPDDDALRAHTEAL
IDVPPDIVIATTGIGFRGWVAAADGWGLAADLIAALSQARIVSRGPKATGALRAAGLPEE
WSPESESSRELLHYLVDGGIDGARIAVQLHGATEDWDPYPEFLDELRAAGADVVPIRVYR
WRPPPHGGDFDQLVAGIAEEKFDAVSFTSAPAVASVLMRAMEMGIEDRVLTALRTNVHAM
CVGPVTARPLVRLGVPTSAPERMRLGALARHITDELPLLCARTMQVAGHLLEIRGTCVLV
DGTVKTVSPAGMATIRALAHHPGAVVSRNALLTALPGSGTDTHAVETAVLRLRTALGDKN
IVSTVVKRGYRLAVDEDLVHAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagcctgactgggcaccgctcaccggcttccgggtggcggtgacttccgctcgc
cgtgccgaggaactgggcgcgctgcttgaacgccgcggcgccacggtgacgagcgcggcc
gcgatcaccatggtgccgcttccggatgacgatgcgttgcgcgcgcacacggaggcgctg
atcgacgtaccgcccgacatcgtgatcgcgaccactggcatcggattccgcggctgggtc
gcggcggccgacggctgggggttggccgccgacctgatcgccgcgctgagccaggcgcgc
atcgtgtcgcgcggtccgaaagccaccggcgcgctgcgcgccgcggggttgcccgaagaa
tggtcgcccgaatcggagtcgtcgcgcgagttgttgcactacctcgtggatggcggcatc
gacggagcgcggatcgcggtgcagctgcacggcgcgaccgaggactgggacccgtacccg
gagttcctcgatgagttgcgtgccgcgggcgccgacgtggtaccgatccgggtctaccgc
tggcgtccaccgccgcacggcggagacttcgaccaactcgtggccgggatcgcggaggag
aagttcgacgcggtgagtttcacctccgcgccggccgtcgcctcggtgttgatgcgggcg
atggagatgggaatcgaggaccgggtcctcaccgcgctgcgcaccaatgtgcacgccatg
tgcgtcgggccggtcacggcgcggccgctggtccggctcggcgtgccgacgtccgcaccg
gaacgcatgcggctgggtgccctggcccggcacatcaccgatgagctgccgctgttgtgc
gcgcgcacgatgcaggtggccggtcatctcttggagatccgcgggacctgcgtgctggtc
gacggcacggtcaagacggtgtcgccggcgggaatggccaccatccgggcgctcgcgcat
catcccggcgcggtggtgtcacgcaacgcgctgctgacggcgctgcccggtagcggcacc
gacacgcacgccgtcgagaccgcggtgttacggctccgaaccgcgttgggcgacaagaac
atcgtgtcaacggtcgtcaagcgcggctatcggctggcagtcgatgaagacttggtgcac
gctctatga

DBGET integrated database retrieval system