KEGG   Mycobacterium rhodesiae: MycrhN_1491Help
Entry
MycrhN_1491       CDS       T01685                                 

Definition
beta-glucosidase-like glycosyl hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mrh  Mycobacterium rhodesiae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MycrhN_1491
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MycrhN_1491
Enzymes [BR:mrh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MycrhN_1491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1524020..1525192)
Genome map
AA seq 390 aa AA seqDB search
MVSIGSGLRALCAAMALPALVSGCSTAAEQEAPAPTMAATAVPQAPLIVPPPACGEGPAL
LSQLSTRDKLAQLLMVGVNNAEDARNVVASQHVGGIMIGSWTDLSMLSDGSLKDIVGSAA
PLPLAVSVDEEGGRVSRLSSVIGTQPPARVLARTQTPEQVYAIALQRGQAMRGLGITIDF
APVVDVSDAPDDTVIGDRSFGSDPAVVTDFAGAYARGLRDAGLLPVLKHFPGHGNGSGDS
HTGSVTAPPIADLQNSDLIPYRTLNAQLPVGVMVGHMQVPGLTGNDPASLSPSAYGLLRS
GGYGGPPFNGPVFTDDLSSMQAISDRLGVAEAALRGLQAGADTALWVTTGEVPAVLDRLE
KAVAAGELSMAAVDASVLRMATVKGPHQRC
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaattggttcggggttgcgcgcgctatgcgctgccatggcactgcccgcgctc
gtgtccggctgttcgaccgccgcggagcaggaggccccggccccgacgatggcggcgacc
gccgtgccgcaggcacccttgatcgtcccgccacccgcatgcggtgagggtccggcgctg
ctgtcacaactgtccacgcgcgacaaactggctcagctgctgatggtgggcgtcaacaac
gcggaggacgcccggaacgtcgtcgcctcgcagcacgtcggcgggatcatgatcgggagc
tggaccgatctgtcgatgctgtccgacggctcgctcaaggacatcgtggggtcggcggcc
ccgctgccgctggcggtcagcgtcgacgaggagggtggccgggtgtcgcggctgtcctcg
gtgatcggcacccagccacctgcgcgggtgttggcgcggacccagactcccgaacaggtg
tacgcgatcgcgctgcagcgcggtcaggcgatgcgaggcctcggcatcacgatcgacttc
gcacccgtggtcgacgtctccgacgcgcccgatgacaccgtgatcggcgaccggtccttc
ggctcggatcccgctgtggtcaccgacttcgccggcgcctacgcccgcggactgcgcgac
gccgggctgctgccggtgctcaagcacttcccggggcacgggaacggctccggtgactcg
cacaccggcagcgtcaccgcaccgccgatcgccgacctgcagaactcggacctgatcccg
taccgcacgctgaacgcacagctgccggtcggggtgatggtcggtcacatgcaggtgcct
ggcctcacgggcaacgacccggccagcctgagccccagtgcatacgggctgctgcgctcc
ggcggctatggcggccccccgttcaacgggcccgtgttcaccgatgacctgtcgtcgatg
caggcgatctccgatcggctcggtgtcgccgaggccgccctgcgcggattgcaggccggt
gccgacaccgcattgtgggtgaccaccggcgaggtgcccgcggtactggaccggttggag
aaggcggtcgctgccggcgagttgtccatggctgcggtcgatgcgtcggtgttgcggatg
gctacggtcaaggggccacatcagcggtgctga

DBGET integrated database retrieval system